| UniProt ID | RFA4_HUMAN | |
|---|---|---|
| UniProt AC | Q13156 | |
| Protein Name | Replication protein A 30 kDa subunit | |
| Gene Name | RPA4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 261 | |
| Subcellular Localization | Nucleus . Localizes to DNA repair foci after DNA damage. | |
| Protein Description | As part of the alternative replication protein A complex, aRPA, binds single-stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S-phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA polymerase delta synthesis in the presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange.. | |
| Protein Sequence | MSKSGFGSYGSISAADGASGGSDQLCERDATPAIKTQRPKVRIQDVVPCNVNQLLSSTVFDPVFKVRGIIVSQVSIVGVIRGAEKASNHICYKIDDMTAKPIEARQWFGREKVKQVTPLSVGVYVKVFGILKCPTGTKSLEVLKIHVLEDMNEFTVHILETVNAHMMLDKARRDTTVESVPVSPSEVNDAGDNDESHRNFIQDEVLRLIHECPHQEGKSIHELRAQLCDLSVKAIKEAIDYLTVEGHIYPTVDREHFKSAD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of RFA4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of RFA4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of RFA4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of RFA4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RFA2_HUMAN | RPA2 | physical | 7760808 | |
| RFA3_HUMAN | RPA3 | physical | 7760808 | |
| RFA1_HUMAN | RPA1 | physical | 7760808 | |
| A4_HUMAN | APP | physical | 21832049 | |
| RFA3_HUMAN | RPA3 | physical | 26186194 | |
| RFA1_HUMAN | RPA1 | physical | 26186194 | |
| XPC_HUMAN | XPC | physical | 26186194 | |
| SP16H_HUMAN | SUPT16H | physical | 26186194 | |
| PARP2_HUMAN | PARP2 | physical | 26186194 | |
| PARP1_HUMAN | PARP1 | physical | 26186194 | |
| SSRP1_HUMAN | SSRP1 | physical | 26186194 | |
| HMCES_HUMAN | HMCES | physical | 26186194 | |
| HMCES_HUMAN | HMCES | physical | 28514442 | |
| XPC_HUMAN | XPC | physical | 28514442 | |
| PARP2_HUMAN | PARP2 | physical | 28514442 | |
| RFA1_HUMAN | RPA1 | physical | 28514442 | |
| RFA3_HUMAN | RPA3 | physical | 28514442 | |
| SP16H_HUMAN | SUPT16H | physical | 28514442 | |
| PARP1_HUMAN | PARP1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
