RARB_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: RARB_HUMAN
• UniProt AC: P10826
• Protein Name: Retinoic acid receptor beta
• Gene Name: RARB
• Organism: Homo sapiens (Human).
• Sequence Length: 455
• Subcellular Localization: Isoform Beta-1: Nucleus.; Isoform Beta-2: Nucleus.; Isoform Beta-4: Cytoplasm.
• Protein Description: Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RXR/RAR heterodimers bind to the retinoic acid response elements (RARE) composed of tandem 5'-AGGTCA-3' sites known as DR1-DR5. In the absence or presence of hormone ligand, acts mainly as an activator of gene expression due to weak binding to corepressors. In concert with RARG, required for skeletal growth, matrix homeostasis and growth plate function..
• Protein Sequence: MTTSGHACPVPAVNGHMTHYPATPYPLLFPPVIGGLSLPPLHGLHGHPPPSGCSTPSPATIETQSTSSEELVPSPPSPLPPPRVYKPCFVCQDKSSGYHYGVSACEGCKGFFRRSIQKNMIYTCHRDKNCVINKVTRNRCQYCRLQKCFEVGMSKESVRNDRNKKKKETSKQECTESYEMTAELDDLTEKIRKAHQETFPSLCQLGKYTTNSSADHRVRLDLGLWDKFSELATKCIIKIVEFAKRLPGFTGLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFTFANQLLPLEMDDTETGLLSAICLICGDRQDLEEPTKVDKLQEPLLEALKIYIRKRRPSKPHMFPKILMKITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEGHEPLTPSSSGNTAEHSPSISPSSVENSGVSQSPLVQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
22 (in isoform 2)	Phosphorylation	-	17.65	-
67 (in isoform 2)	Phosphorylation	-	40.79	25850435
70 (in isoform 2)	Phosphorylation	-	57.95	25850435
77	Phosphorylation	ELVPSPPSPLPPPRV CCCCCCCCCCCCCCC	42.31	2836738
96	Phosphorylation	FVCQDKSSGYHYGVS EEEECCCCCCEEEEH	49.46	16417524
122	Phosphorylation	SIQKNMIYTCHRDKN HHHHCEEEEECCCCC	7.79	29083192
123	Phosphorylation	IQKNMIYTCHRDKNC HHHCEEEEECCCCCC	7.30	29083192
250	Phosphorylation	AKRLPGFTGLTIADQ HHHCCCCCCCCHHHH	36.88	-
346	Phosphorylation	RQDLEEPTKVDKLQE CCCCCCCCCCCCCHH	47.16	24732914
369	O-linked_Glycosylation	YIRKRRPSKPHMFPK HHHHCCCCCCCCCHH	57.94	29351928
382	Phosphorylation	PKILMKITDLRSISA HHHHHHHHCHHHCCC	24.38	23532336
405	Phosphorylation	LKMEIPGSMPPLIQE EEEECCCCCCHHHHH	23.82	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
-	K	Ubiquitination	E3 ubiquitin ligase	HACE1	Q8IYU2	PMID:19350571

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of RARB_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of RARB_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RXRG_HUMAN	RXRG	physical	20211142
HAIR_HUMAN	HR	physical	20211142
RXRA_HUMAN	RXRA	physical	15528208
NCOA1_HUMAN	NCOA1	physical	15604093
RXRB_HUMAN	RXRB	physical	15604093
RXRG_HUMAN	RXRG	physical	15604093
PNRC1_HUMAN	PNRC1	physical	15604093
MAP6_HUMAN	MAP6	physical	15604093
RXRB_HUMAN	RXRB	physical	25416956
RXRG_HUMAN	RXRG	physical	25416956
PRS8_HUMAN	PSMC5	physical	15604093

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.