dbPTM

RAD7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	RAD7_SCHPO
UniProt AC	O74999
Protein Name	DNA repair protein rhp7
Gene Name	rhp7
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	563
Subcellular Localization	Nucleus .
Protein Description	Involved in global genome repair (GGR) via nucleotide excision repair (NER), in conjunction with rhp16, after UV irradiation..
Protein Sequence	MSSGSRVRGPNSALTEFLRSQGINASALGRARPPRQSEESAGQSTGTESEVIQTPTSVEENNEDENSMSTTTIEIPVVKRRNLRNQKKKKKTDEEAEDNEDTFSMNSRAGFSYKAREHTGKLDFCAHCNCRFTITPYSKYSNSEKGWLCYPCSRGAEDRSVPELRTRKRKALTRKKVAAATMDEEISVPKLQDLCIRVIAEYINDIEAFGDIGQVNMDKISQIISKNRSLNDTTVKLFLSGGQTELKLYDCSKITADSLFQIAQYCPNLQTLHLTYCGQMQDQVLHFYADHLTELTDVSFQGAFLVSSSEWINFFKKRGSKLISLELTDTARIHVSVINAIVDCCPNLISLNLSRIFYLDDECVRLLAGCRNLVSLKIESPGGIINDGSILDVLNQIGSGLHTLSLSGCTKLTDEVLKQGIGPCCGRLKHLNLSGLELLTDDEASIVFGEWKIQSGLETLSLRRCLSLGDKTVRAVLVNSGHTLRTLDLNGMSFVTDEALQYIVNFPLPMLKALDVSWIRGMNDKLVCDFESKKPTLEKLLVWGDNHVLMPSNRLLLIGREVQ

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of RAD7_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of RAD7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of RAD7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of RAD7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
ATL1_SCHPO	atl1	genetic	22658721
RHP26_SCHPO	rhp26	genetic	22658721
RHP26_SCHPO	rhp26	genetic	12807767
UVE1_SCHPO	uve1	genetic	12807767
NSE6_SCHPO	nse6	genetic	22681890
PDK_SCHPO	pkp1	genetic	22681890
RM01_SCHPO	SPAC1610.02c	genetic	22681890
GEF1_SCHPO	gef1	genetic	22681890
MAD1_SCHPO	mad1	genetic	22681890

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of RAD7_SCHPO

Related Literatures of Post-Translational Modification