UniProt ID | PTF1_SCHPO | |
---|---|---|
UniProt AC | Q9P6N2 | |
Protein Name | Pdp3-interacting factor 1 | |
Gene Name | ptf1 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 229 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | Component of the mst2 complex which is a highly specific H3 lysine 14 (H3K14) acetyltransferase that functions together with gcn5 to regulate global levels of H3K14 acetylation (H3K14ac), critical for DNA damage checkpoint activation.. | |
Protein Sequence | MAQKKQLYVFSDFDGTITLQDSNDYLTDNFGMGNANRVNLNQQVLDGSISFRDAFAKMLDSVHLSYDEALEVLKKNVAIDPSFKPFYEWCKSQDIRVIILSSGMEPFIRALFEQYLGKEEASSIEIVSNDINVHPDGQWNIVYHDDSHFGHDKSLTIRPYAQLPESKRPHMVYCGDGVSDLSAAKETEHLFAKKGRDLIKYCEREKISFSEFETFADIHKDLQKLFFSS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of PTF1_SCHPO !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTF1_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTF1_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTF1_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
AMO1_SCHPO | amo1 | genetic | 18818364 | |
SWD2_SCHPO | swd2 | genetic | 18818364 | |
VPS71_SCHPO | vps71 | genetic | 18818364 | |
BDC1_SCHPO | bdc1 | genetic | 22681890 | |
6PGL_SCHPO | SPCC16C4.10 | genetic | 22681890 | |
NUP60_SCHPO | nup60 | genetic | 22681890 | |
CAT1_SCHPO | cat1 | genetic | 22681890 | |
YE08_SCHPO | SPAC17H9.08 | genetic | 22681890 | |
OBP1_SCHPO | SPBC646.08c | genetic | 22681890 | |
PAB2_SCHPO | pab2 | genetic | 22681890 | |
TRX2_SCHPO | trx2 | genetic | 22681890 | |
POF9_SCHPO | pof9 | genetic | 22681890 | |
VPS38_SCHPO | vps38 | genetic | 22681890 | |
GMA12_SCHPO | gma12 | genetic | 22681890 | |
ASE1_SCHPO | ase1 | genetic | 22681890 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...