UniProt ID | PRRT2_HUMAN | |
---|---|---|
UniProt AC | Q7Z6L0 | |
Protein Name | Proline-rich transmembrane protein 2 | |
Gene Name | PRRT2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 340 | |
Subcellular Localization | Cell membrane . Cell junction, synapse, presynaptic cell membrane . Cell junction, synapse . Cell projection, axon . Cytoplasmic vesicle, secretory vesicle, synaptic vesicle membrane . Cell junction, synapse, postsynaptic cell membrane, postsynaptic densi | |
Protein Description | As a component of the outer core of AMPAR complex, may be involved in synaptic transmission in the central nervous system. In hippocampal neurons, in presynaptic terminals, plays an important role in the final steps of neurotransmitter release, possibly by regulating Ca(2+)-sensing. In the cerebellum, may inhibit SNARE complex formation and downregulate short-term facilitation.. | |
Protein Sequence | MAASSSEISEMKGVEESPKVPGEGPGHSEAETGPPQVLAGVPDQPEAPQPGPNTTAAPVDSGPKAGLAPETTETPAGASETAQATDLSLSPGGESKANCSPEDPCQETVSKPEVSKEATADQGSRLESAAPPEPAPEPAPQPDPRPDSQPTPKPALQPELPTQEDPTPEILSESVGEKQENGAVVPLQAGDGEEGPAPEPHSPPSKKSPPANGAPPRVLQQLVEEDRMRRAHSGHPGSPRGSLSRHPSSQLAGPGVEGGEGTQKPRDYIILAILSCFCPMWPVNIVAFAYAVMSRNSLQQGDVDGAQRLGRVAKLLSIVALVGGVLIIIASCVINLGVYK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MAASSSEISEM ----CCCCHHHHHHH | 25.51 | 24719451 | |
5 | Phosphorylation | ---MAASSSEISEMK ---CCCCHHHHHHHC | 27.54 | 24719451 | |
28 | Phosphorylation | PGEGPGHSEAETGPP CCCCCCCCCCCCCCC | 44.40 | - | |
53 | N-linked_Glycosylation | EAPQPGPNTTAAPVD CCCCCCCCCCCCCCC | 56.85 | UniProtKB CARBOHYD | |
74 | Phosphorylation | LAPETTETPAGASET CCCCCCCCCCCCCCC | 19.15 | - | |
88 | Phosphorylation | TAQATDLSLSPGGES CCCCCCCCCCCCCCC | 29.61 | 24076635 | |
90 | Phosphorylation | QATDLSLSPGGESKA CCCCCCCCCCCCCCC | 20.37 | 18510355 | |
95 | Phosphorylation | SLSPGGESKANCSPE CCCCCCCCCCCCCCC | 40.10 | 24076635 | |
100 | Phosphorylation | GESKANCSPEDPCQE CCCCCCCCCCCCHHC | 31.00 | 24076635 | |
202 | Phosphorylation | GPAPEPHSPPSKKSP CCCCCCCCCCCCCCC | 49.58 | 20886841 | |
205 | Phosphorylation | PEPHSPPSKKSPPAN CCCCCCCCCCCCCCC | 56.98 | 20886841 | |
208 | Phosphorylation | HSPPSKKSPPANGAP CCCCCCCCCCCCCCC | 39.59 | 20886841 | |
233 | Phosphorylation | DRMRRAHSGHPGSPR HHHHHHHCCCCCCCC | 37.50 | - | |
238 | Phosphorylation | AHSGHPGSPRGSLSR HHCCCCCCCCCCCCC | 18.84 | 25332170 | |
240 | Methylation | SGHPGSPRGSLSRHP CCCCCCCCCCCCCCC | 49.37 | - | |
242 | Phosphorylation | HPGSPRGSLSRHPSS CCCCCCCCCCCCCCH | 25.17 | 25332170 | |
244 | Phosphorylation | GSPRGSLSRHPSSQL CCCCCCCCCCCCHHC | 30.18 | 25332170 | |
248 | Phosphorylation | GSLSRHPSSQLAGPG CCCCCCCCHHCCCCC | 25.29 | 25332170 | |
249 | Phosphorylation | SLSRHPSSQLAGPGV CCCCCCCHHCCCCCC | 33.39 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PRRT2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PRRT2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PRRT2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
NDUV3_HUMAN | NDUFV3 | physical | 26186194 | |
CALL5_HUMAN | CALML5 | physical | 26186194 | |
NDUB9_HUMAN | NDUFB9 | physical | 26186194 | |
NDUB8_HUMAN | NDUFB8 | physical | 26186194 | |
TBRG4_HUMAN | TBRG4 | physical | 26186194 | |
NDUS4_HUMAN | NDUFS4 | physical | 26186194 | |
DDI1_HUMAN | DDI1 | physical | 26186194 | |
LCLT1_HUMAN | LCLAT1 | physical | 26186194 | |
NDUS4_HUMAN | NDUFS4 | physical | 28514442 | |
NDUB8_HUMAN | NDUFB8 | physical | 28514442 | |
DDI1_HUMAN | DDI1 | physical | 28514442 | |
NDUB9_HUMAN | NDUFB9 | physical | 28514442 | |
LCLT1_HUMAN | LCLAT1 | physical | 28514442 | |
NDUV3_HUMAN | NDUFV3 | physical | 28514442 | |
TBRG4_HUMAN | TBRG4 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
128200 | Episodic kinesigenic dyskinesia 1 (EKD1) | |||||
602066 | Convulsions, familial infantile, with paroxysmal choreoathetosis (ICCA) | |||||
605751 | Seizures, benign familial infantile 2 (BFIS2) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...