| UniProt ID | PCP2_MOUSE | |
|---|---|---|
| UniProt AC | P12660 | |
| Protein Name | Purkinje cell protein 2 | |
| Gene Name | Pcp2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 120 | |
| Subcellular Localization | ||
| Protein Description | May function as a cell-type specific modulator for G protein-mediated cell signaling.. | |
| Protein Sequence | MAGSPDQEGFFNLLTHVQGDRMEEQRCSLQAGPGQNPESQGGPAPEMDNLMDMLVNTQGRRMDDQRVTVNSLPGFQPIGPKDGMQKRPGTLSPQPLLTPQDPAALSFRRNSSPQPQTQAP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MAGSPDQEGFF ----CCCCCCCCHHH | 18.76 | 22324799 | |
| 90 | Phosphorylation | GMQKRPGTLSPQPLL CCCCCCCCCCCCCCC | 27.09 | 22324799 | |
| 92 | Phosphorylation | QKRPGTLSPQPLLTP CCCCCCCCCCCCCCC | 22.71 | 22324799 | |
| 98 | Phosphorylation | LSPQPLLTPQDPAAL CCCCCCCCCCCHHHH | 26.96 | 22324799 | |
| 106 | Phosphorylation | PQDPAALSFRRNSSP CCCHHHHHCCCCCCC | 16.39 | 24925903 | |
| 111 | Phosphorylation | ALSFRRNSSPQPQTQ HHHCCCCCCCCCCCC | 41.40 | 25521595 | |
| 112 | Phosphorylation | LSFRRNSSPQPQTQA HHCCCCCCCCCCCCC | 30.97 | 25521595 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCP2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCP2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCP2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| CTNB1_MOUSE | Ctnnb1 | physical | 16973135 | |
| CTNA1_MOUSE | Ctnna1 | physical | 16973135 | |
| ACTN1_MOUSE | Actn1 | physical | 16973135 | |
| PLAK_MOUSE | Jup | physical | 16973135 | |
| GNAI2_MOUSE | Gnai2 | physical | 10196137 | |
| GNAS2_MOUSE | Gnas | physical | 10196137 | |
| ALEX_MOUSE | Gnas | physical | 10196137 | |
| GNAS1_MOUSE | Gnas | physical | 10196137 | |
| GNAS3_MOUSE | Gnas | physical | 10196137 | |
| GNAO_MOUSE | Gnao1 | physical | 10196137 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
