| UniProt ID | OPCM_HUMAN | |
|---|---|---|
| UniProt AC | Q14982 | |
| Protein Name | Opioid-binding protein/cell adhesion molecule | |
| Gene Name | OPCML | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 345 | |
| Subcellular Localization |
Cell membrane Lipid-anchor, GPI-anchor. |
|
| Protein Description | Binds opioids in the presence of acidic lipids; probably involved in cell contact.. | |
| Protein Sequence | MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTIDDRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVPPQIMNISSDITVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGFVSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKGILSCEASAVPMAEFQWFKEETRLATGLDGMRIENKGRMSTLTFFNVSEKDYGNYTCVATNKLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 44 | N-linked_Glycosylation | TFPKAMDNVTVRQGE CCCCCCCCEEEECCC | 20.48 | UniProtKB CARBOHYD | |
| 54 | Phosphorylation | VRQGESATLRCTIDD EECCCCEEEEEEECC | 24.82 | 23403867 | |
| 70 | N-linked_Glycosylation | VTRVAWLNRSTILYA CEEEEEEECCEEEEE | 25.75 | UniProtKB CARBOHYD | |
| 140 | N-linked_Glycosylation | QVPPQIMNISSDITV ECCCCEEEECCCEEE | 32.40 | UniProtKB CARBOHYD | |
| 217 | Ubiquitination | APDVRKVKITVNYPP CCCCCEEEEEECCCC | 35.38 | - | |
| 228 | Ubiquitination | NYPPYISKAKNTGVS CCCCCCCCCCCCCCC | 54.55 | - | |
| 285 | N-linked_Glycosylation | MSTLTFFNVSEKDYG CCEEEEEECCHHHCC | 32.01 | UniProtKB CARBOHYD | |
| 293 | N-linked_Glycosylation | VSEKDYGNYTCVATN CCHHHCCCEEEEEEC | 23.78 | UniProtKB CARBOHYD | |
| 306 | N-linked_Glycosylation | TNKLGNTNASITLYG ECCCCCCCCEEEEEC | 35.37 | UniProtKB CARBOHYD | |
| 322 | GPI-anchor | GAVIDGVNSASRALA CCEEECCCHHHHHHH | 37.07 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OPCM_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OPCM_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OPCM_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| K1C40_HUMAN | KRT40 | physical | 25416956 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| MBLC2_HUMAN | MBLAC2 | physical | 28514442 | |
| TRIPC_HUMAN | TRIP12 | physical | 28514442 | |
| TM214_HUMAN | TMEM214 | physical | 28514442 | |
| CALX_HUMAN | CANX | physical | 28514442 | |
| NCAM1_HUMAN | NCAM1 | physical | 28514442 | |
| FBX2_HUMAN | FBXO2 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
