UniProt ID | NOV_HUMAN | |
---|---|---|
UniProt AC | P48745 | |
Protein Name | Protein NOV homolog | |
Gene Name | NOV | |
Organism | Homo sapiens (Human). | |
Sequence Length | 357 | |
Subcellular Localization | Secreted. Cytoplasm . Cell junction, gap junction . Localizes at the Gap junction in presence of GJA1/CX43. | |
Protein Description | Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival. [PubMed: 15181016] | |
Protein Sequence | MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of NOV_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOV_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOV_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOV_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RPAB5_HUMAN | POLR2L | physical | 10474687 | |
ITAV_HUMAN | ITGAV | physical | 12902636 | |
FINC_HUMAN | FN1 | physical | 12902636 | |
IGF1_HUMAN | IGF1 | physical | 10084601 | |
IGF2_HUMAN | IGF2 | physical | 10084601 | |
INS_HUMAN | INS | physical | 10084601 | |
NOTC1_HUMAN | NOTCH1 | physical | 12050162 | |
FBLN1_HUMAN | FBLN1 | physical | 9927660 | |
NFKB1_HUMAN | NFKB1 | physical | 26186194 | |
TF65_HUMAN | RELA | physical | 26186194 | |
FBX21_HUMAN | FBXO21 | physical | 26186194 | |
S10A4_HUMAN | S100A4 | physical | 12147716 | |
NFKB1_HUMAN | NFKB1 | physical | 28514442 | |
TF65_HUMAN | RELA | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...