| UniProt ID | NOV_HUMAN | |
|---|---|---|
| UniProt AC | P48745 | |
| Protein Name | Protein NOV homolog | |
| Gene Name | NOV | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 357 | |
| Subcellular Localization | Secreted. Cytoplasm . Cell junction, gap junction . Localizes at the Gap junction in presence of GJA1/CX43. | |
| Protein Description | Immediate-early protein playing a role in various cellular processes including proliferation, adhesion, migration, differentiation and survival. [PubMed: 15181016] | |
| Protein Sequence | MQSVQSTSFCLRKQCLCLTFLLLHLLGQVAATQRCPPQCPGRCPATPPTCAPGVRAVLDGCSCCLVCARQRGESCSDLEPCDESSGLYCDRSADPSNQTGICTAVEGDNCVFDGVIYRSGEKFQPSCKFQCTCRDGQIGCVPRCQLDVLLPEPNCPAPRKVEVPGECCEKWICGPDEEDSLGGLTLAAYRPEATLGVEVSDSSVNCIEQTTEWTACSKSCGMGFSTRVTNRNRQCEMLKQTRLCMVRPCEQEPEQPTDKKGKKCLRTKKSLKAIHLQFKNCTSLHTYKPRFCGVCSDGRCCTPHNTKTIQAEFQCSPGQIVKKPVMVIGTCTCHTNCPKNNEAFLQELELKTTRGKM | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
|---|---|---|---|---|---|---|
Oops, there are no PTM records of NOV_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of NOV_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of NOV_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of NOV_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| RPAB5_HUMAN | POLR2L | physical | 10474687 | |
| ITAV_HUMAN | ITGAV | physical | 12902636 | |
| FINC_HUMAN | FN1 | physical | 12902636 | |
| IGF1_HUMAN | IGF1 | physical | 10084601 | |
| IGF2_HUMAN | IGF2 | physical | 10084601 | |
| INS_HUMAN | INS | physical | 10084601 | |
| NOTC1_HUMAN | NOTCH1 | physical | 12050162 | |
| FBLN1_HUMAN | FBLN1 | physical | 9927660 | |
| NFKB1_HUMAN | NFKB1 | physical | 26186194 | |
| TF65_HUMAN | RELA | physical | 26186194 | |
| FBX21_HUMAN | FBXO21 | physical | 26186194 | |
| S10A4_HUMAN | S100A4 | physical | 12147716 | |
| NFKB1_HUMAN | NFKB1 | physical | 28514442 | |
| TF65_HUMAN | RELA | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
