UniProt ID | IGF1_HUMAN | |
---|---|---|
UniProt AC | P05019 | |
Protein Name | Insulin-like growth factor I | |
Gene Name | IGF1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 195 | |
Subcellular Localization | Secreted . | |
Protein Description | The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation. [PubMed: 21076856] | |
Protein Sequence | MGKISSLPTQLFKCCFCDFLKVKMHTMSSSHLFYLALCLLTFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKYQPPSTNKNTKSQRRKGWPKTHPGGEQKEGTEASLQIRGKKKEQRREIGSRNAECRGKKGK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
135 | Phosphorylation | DMPKTQKYQPPSTNK CCCCCCCCCCCCCCC | 19.21 | - | |
135 (in isoform 3) | Phosphorylation | - | 19.21 | - | |
144 | Phosphorylation | PPSTNKNTKSQRRKG CCCCCCCCHHHHHCC | 33.41 | 28258704 | |
151 (in isoform 2) | Phosphorylation | - | 44.07 | - | |
168 | Phosphorylation | QKEGTEASLQIRGKK CCCCCCHHHEECCCH | 17.99 | 29507054 | |
184 | Phosphorylation | EQRREIGSRNAECRG HHHHHHHHCCHHHCC | 28.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of IGF1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IGF1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IGF1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IBP7_HUMAN | IGFBP7 | physical | 14521955 | |
IBP3_HUMAN | IGFBP3 | physical | 12735930 | |
IBP3_HUMAN | IGFBP3 | physical | 10823924 | |
ALS_HUMAN | IGFALS | physical | 10823924 | |
IBP4_HUMAN | IGFBP4 | physical | 7683646 | |
IBP2_HUMAN | IGFBP2 | physical | 11063745 | |
IBP3_HUMAN | IGFBP3 | physical | 9497324 | |
IBP5_HUMAN | IGFBP5 | physical | 9497324 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
608747 | Insulin-like growth factor I deficiency (IGF1 deficiency) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...