UniProt ID | IBP7_HUMAN | |
---|---|---|
UniProt AC | Q16270 | |
Protein Name | Insulin-like growth factor-binding protein 7 | |
Gene Name | IGFBP7 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 282 | |
Subcellular Localization | Secreted. | |
Protein Description | Binds IGF-I and IGF-II with a relatively low affinity. Stimulates prostacyclin (PGI2) production. Stimulates cell adhesion.. | |
Protein Sequence | MERPSLRALLLGAAGLLLLLLPLSSSSSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | O-linked_Glycosylation | SSSSSSDTCGPCEPA CCCCCCCCCCCCCCC | 22.70 | OGP | |
39 | O-linked_Glycosylation | CGPCEPASCPPLPPL CCCCCCCCCCCCCCC | 37.56 | OGP | |
114 | Ubiquitination | VSGVCVCKSRYPVCG CCCEEEECCCCCCCC | 19.99 | 29967540 | |
117 | Phosphorylation | VCVCKSRYPVCGSDG EEEECCCCCCCCCCC | 13.70 | - | |
122 | Phosphorylation | SRYPVCGSDGTTYPS CCCCCCCCCCCCCCC | 27.95 | - | |
137 | Phosphorylation | GCQLRAASQRAESRG HHHHHHHHHHHHHHH | 21.15 | - | |
142 | Phosphorylation | AASQRAESRGEKAIT HHHHHHHHHHCHHEE | 44.60 | - | |
146 | Ubiquitination | RAESRGEKAITQVSK HHHHHHCHHEEECCC | 48.16 | 29967540 | |
149 | Phosphorylation | SRGEKAITQVSKGTC HHHCHHEEECCCCCC | 27.98 | 28060719 | |
153 | Ubiquitination | KAITQVSKGTCEQGP HHEEECCCCCCCCCC | 60.42 | 29967540 | |
171 | N-linked_Glycosylation | TPPKDIWNVTGAQVY CCCHHHCCCCCCEEE | 23.08 | 8939990 | |
188 | O-linked_Glycosylation | CEVIGIPTPVLIWNK EEEECCCCCEEECCC | 24.90 | OGP | |
201 | Phosphorylation | NKVKRGHYGVQRTEL CCCCCCCCCEECCEE | 23.09 | - | |
206 | O-linked_Glycosylation | GHYGVQRTELLPGDR CCCCEECCEECCCCC | 17.56 | 55831157 | |
206 | Phosphorylation | GHYGVQRTELLPGDR CCCCEECCEECCCCC | 17.56 | - | |
220 | O-linked_Glycosylation | RDNLAIQTRGGPEKH CCCEEEEECCCCCCC | 25.76 | 55824677 | |
230 | O-linked_Glycosylation | GPEKHEVTGWVLVSP CCCCCEEEEEEEEEC | 23.49 | 55824683 | |
236 | O-linked_Glycosylation | VTGWVLVSPLSKEDA EEEEEEEECCCHHHC | 18.89 | 55826111 | |
236 | Phosphorylation | VTGWVLVSPLSKEDA EEEEEEEECCCHHHC | 18.89 | 22199227 | |
239 | Phosphorylation | WVLVSPLSKEDAGEY EEEEECCCHHHCCCE | 37.07 | 22199227 | |
246 | Phosphorylation | SKEDAGEYECHASNS CHHHCCCEEEECCCC | 23.96 | 26091039 | |
253 | Phosphorylation | YECHASNSQGQASAS EEEECCCCCCCCCCC | 32.94 | - | |
264 | O-linked_Glycosylation | ASASAKITVVDALHE CCCCCEEEEEEHHHC | 17.48 | 55824287 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
239 | S | Phosphorylation | Kinase | FAM20C | Q8IXL6 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of IBP7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of IBP7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
IGF1_HUMAN | IGF1 | physical | 8939990 | |
IGF2_HUMAN | IGF2 | physical | 8939990 | |
CHMP3_HUMAN | CHMP3 | physical | 11549700 | |
VEGFA_HUMAN | VEGFA | physical | 12407018 | |
INS_HUMAN | INS | physical | 9388210 | |
RTN4_HUMAN | RTN4 | physical | 22939629 | |
CTIP_HUMAN | RBBP8 | physical | 21988832 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
614224 | Retinal arterial macroaneurysm with supravalvular pulmonic stenosis (RAMSVPS) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...