NDK2_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: NDK2_ARATH
• UniProt AC: O64903
• Protein Name: Nucleoside diphosphate kinase II, chloroplastic
• Gene Name: NDPK2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 231
• Subcellular Localization: Plastid, chloroplast .
• Protein Description: Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. May activate MPK3 and MPK6. May be involved in the regulation of cellular redox state and hydrogen peroxide-mediated MAP kinase signaling..
• Protein Sequence: MVGATVVSKWTPLCVASPPERNSASLNPHCSPARVNFRTALAAFRPQFRLFSRNSASRRRLRASSSAESGIFLPHLVASMEDVEETYIMVKPDGIQRGLVGEIISRFEKKGFKLIGLKMFQCPKELAEEHYKDLSAKSFFPNLIEYITSGPVVCMAWEGVGVVASARKLIGKTDPLQAEPGTIRGDLAVQTGRNIVHGSDSPENGKREIGLWFKEGELCKWDSALATWLRE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
131	Phosphorylation	KELAEEHYKDLSAKS HHHHHHHHHHHCHHH	14.96	30291188
135	Phosphorylation	EEHYKDLSAKSFFPN HHHHHHHCHHHHCCC	43.73	25561503
199	Phosphorylation	GRNIVHGSDSPENGK CCCEECCCCCCCCCC	21.75	23776212
201	Phosphorylation	NIVHGSDSPENGKRE CEECCCCCCCCCCEE	35.49	23776212

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of NDK2_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of NDK2_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of NDK2_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
GPA1_ARATH	GP ALPHA 1	physical	18823588
MPK3_ARATH	MPK3	physical	12506203
MPK6_ARATH	MPK6	physical	12506203
PHYA_ARATH	PHYA	physical	15465053
CIPKO_ARATH	SOS2	physical	17785451
CIPKE_ARATH	SR1	physical	17785451
NDK2_ARATH	NDPK2	physical	17785451
CIPKO_ARATH	SOS2	genetic	17785451

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-201, AND MASSSPECTROMETRY.
PubMed: 19376835