UniProt ID | MYCBP_HUMAN | |
---|---|---|
UniProt AC | Q99417 | |
Protein Name | c-Myc-binding protein | |
Gene Name | MYCBP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 103 | |
Subcellular Localization | Cytoplasm. Nucleus. Mitochondrion. Translocates into the nucleus in the S phase of the cell cycle upon an increase of MYC expression. Found in the mitochondria when associated with AKAP1. | |
Protein Description | May control the transcriptional activity of MYC. Stimulates the activation of E box-dependent transcription by MYC.. | |
Protein Sequence | MAHYKAADSKREQFRRYLEKSGVLDTLTKVLVALYEEPEKPNSALDFLKHHLGAATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Acetylation | ---MAHYKAADSKRE ---CCCCCCCHHHHH | 27.51 | 25953088 | |
5 | Ubiquitination | ---MAHYKAADSKRE ---CCCCCCCHHHHH | 27.51 | 33845483 | |
10 | Ubiquitination | HYKAADSKREQFRRY CCCCCHHHHHHHHHH | 61.58 | 24816145 | |
20 | Acetylation | QFRRYLEKSGVLDTL HHHHHHHHHCHHHHH | 50.33 | 23954790 | |
20 | Ubiquitination | QFRRYLEKSGVLDTL HHHHHHHHHCHHHHH | 50.33 | 21890473 | |
20 | Ubiquitination | QFRRYLEKSGVLDTL HHHHHHHHHCHHHHH | 50.33 | 23000965 | |
29 | Ubiquitination | GVLDTLTKVLVALYE CHHHHHHHHHHHHHC | 36.36 | - | |
35 | Phosphorylation | TKVLVALYEEPEKPN HHHHHHHHCCCCCCC | 14.44 | 27642862 | |
40 | Ubiquitination | ALYEEPEKPNSALDF HHHCCCCCCCCHHHH | 61.28 | 33845483 | |
56 | Phosphorylation | KHHLGAATPENPEIE HHHHCCCCCCCHHHH | 30.51 | 28450419 | |
75 | Acetylation | ELAEMKEKYEAIVEE HHHHHHHHHHHHHHH | 42.76 | 25953088 | |
76 | Phosphorylation | LAEMKEKYEAIVEEN HHHHHHHHHHHHHHH | 16.22 | 26657352 | |
84 | Acetylation | EAIVEENKKLKAKLA HHHHHHHHHHHHHHH | 63.86 | 25953088 | |
84 | Ubiquitination | EAIVEENKKLKAKLA HHHHHHHHHHHHHHH | 63.86 | 33845483 | |
89 | Acetylation | ENKKLKAKLAQYEPP HHHHHHHHHHHCCCC | 42.65 | 25953088 | |
89 | Ubiquitination | ENKKLKAKLAQYEPP HHHHHHHHHHHCCCC | 42.65 | 29967540 | |
100 | Ubiquitination | YEPPQEEKRAE---- CCCCHHHHHCC---- | 57.04 | 32015554 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of MYCBP_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of MYCBP_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of MYCBP_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MYBPP_HUMAN | MYCBPAP | physical | 12151104 | |
COF1_HUMAN | CFL1 | physical | 16169070 | |
ARH40_HUMAN | ARHGEF40 | physical | 16169070 | |
DISP3_HUMAN | PTCHD2 | physical | 16169070 | |
SSRP1_HUMAN | SSRP1 | physical | 16169070 | |
CSN6_HUMAN | COPS6 | physical | 16169070 | |
GDF9_HUMAN | GDF9 | physical | 16169070 | |
PTN_HUMAN | PTN | physical | 16169070 | |
CFA91_HUMAN | MAATS1 | physical | 12223483 | |
MYC_HUMAN | MYC | physical | 9797456 | |
AKAP1_HUMAN | AKAP1 | physical | 11483602 | |
REPI1_HUMAN | REPIN1 | physical | 22863883 | |
IF5AL_HUMAN | EIF5AL1 | physical | 26344197 | |
TCTP_HUMAN | TPT1 | physical | 26344197 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...