dbPTM

LSP2_DROME - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	LSP2_DROME
UniProt AC	Q24388
Protein Name	Larval serum protein 2
Gene Name	Lsp2
Organism	Drosophila melanogaster (Fruit fly).
Sequence Length	701
Subcellular Localization	Secreted, extracellular space.
Protein Description	Larval storage protein (LSP) which may serve as a store of amino acids for synthesis of adult proteins..
Protein Sequence	MKSFTVIALAAVALLATLGQAKHLDSKVADKDFLMKQKFMYQILQHIYQDDVFTTPFGGSYVEYKPWEHVADYVHPEMLEHFFELWQHQPFTDDMVWSVMYDKHEEYVVGLVRLFYFAKNWETFQHVVYWARQHVNKQLFVYAVTIASLFRDDMQGVVLPAHYEIHPWSYFDSQALEWAEHYKMHGFHHVKQMDNIYNVVIRTNYSNVHGSLNYDHDLAYYLEDVGFNAFYYYFNLDYPFWTKGGEEHVLNKDRRGELYLYVHWQLLARWYLERLSHDLGEVPAFNMYVPTESGYASNLRTYYGVPQWHRENHHSFYHEHNYEHIEHVEMYTQRVMDWIHKNEKFDVETINVLGNIIQGNADSVDKKFYGSLDKLYRFIVNEGHHYGHGDESFPGLFMHYDTSMRDPIFYEVYKTIVSHYWHLMETYPEYHKKDYAFEGVHIDAVHMPESLTTYFEHFDSDISNAVNVEPAVEGSADPLYTFGRNSHYKGSSYVIKARQQRLNHKPFEFTLDVTSDKAQDAVVKVFIGPKYDEHGHEIPLEHNYQNFFELEHFKVHLEAGVNHIKRASGDFSFWVNDRTTYLELYQKLMDATNSDYKFKLDQSEAHCGVPNRMMLPRGKKGGQVFQFFYMVYPYHQPEVAQFTGYDPVVSCGVGHGSRYVDALPFGFPFNRPVKHDYYFDVHNFKFVDVKIFHRDEHTNVV

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
204	N-linked_Glycosylation	YNVVIRTNYSNVHGS EEEEEEECCCCCCCC	28.52	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of LSP2_DROME !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of LSP2_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of LSP2_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
APLP_DROME	Rfabg	physical	22036573
VIT3_DROME	Yp3	physical	22036573
VIT2_DROME	Yp2	physical	22036573
NPLP2_DROME	Nplp2	physical	22036573
VIT1_DROME	Yp1	physical	22036573
PYG_DROME	GlyP	physical	22036573
PGK_DROME	Pgk	physical	22036573

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of LSP2_DROME

Related Literatures of Post-Translational Modification