UniProt ID | LSP2_DROME | |
---|---|---|
UniProt AC | Q24388 | |
Protein Name | Larval serum protein 2 | |
Gene Name | Lsp2 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 701 | |
Subcellular Localization | Secreted, extracellular space. | |
Protein Description | Larval storage protein (LSP) which may serve as a store of amino acids for synthesis of adult proteins.. | |
Protein Sequence | MKSFTVIALAAVALLATLGQAKHLDSKVADKDFLMKQKFMYQILQHIYQDDVFTTPFGGSYVEYKPWEHVADYVHPEMLEHFFELWQHQPFTDDMVWSVMYDKHEEYVVGLVRLFYFAKNWETFQHVVYWARQHVNKQLFVYAVTIASLFRDDMQGVVLPAHYEIHPWSYFDSQALEWAEHYKMHGFHHVKQMDNIYNVVIRTNYSNVHGSLNYDHDLAYYLEDVGFNAFYYYFNLDYPFWTKGGEEHVLNKDRRGELYLYVHWQLLARWYLERLSHDLGEVPAFNMYVPTESGYASNLRTYYGVPQWHRENHHSFYHEHNYEHIEHVEMYTQRVMDWIHKNEKFDVETINVLGNIIQGNADSVDKKFYGSLDKLYRFIVNEGHHYGHGDESFPGLFMHYDTSMRDPIFYEVYKTIVSHYWHLMETYPEYHKKDYAFEGVHIDAVHMPESLTTYFEHFDSDISNAVNVEPAVEGSADPLYTFGRNSHYKGSSYVIKARQQRLNHKPFEFTLDVTSDKAQDAVVKVFIGPKYDEHGHEIPLEHNYQNFFELEHFKVHLEAGVNHIKRASGDFSFWVNDRTTYLELYQKLMDATNSDYKFKLDQSEAHCGVPNRMMLPRGKKGGQVFQFFYMVYPYHQPEVAQFTGYDPVVSCGVGHGSRYVDALPFGFPFNRPVKHDYYFDVHNFKFVDVKIFHRDEHTNVV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
204 | N-linked_Glycosylation | YNVVIRTNYSNVHGS EEEEEEECCCCCCCC | 28.52 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of LSP2_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of LSP2_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of LSP2_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
APLP_DROME | Rfabg | physical | 22036573 | |
VIT3_DROME | Yp3 | physical | 22036573 | |
VIT2_DROME | Yp2 | physical | 22036573 | |
NPLP2_DROME | Nplp2 | physical | 22036573 | |
VIT1_DROME | Yp1 | physical | 22036573 | |
PYG_DROME | GlyP | physical | 22036573 | |
PGK_DROME | Pgk | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...