UniProt ID | VIT1_DROME | |
---|---|---|
UniProt AC | P02843 | |
Protein Name | Vitellogenin-1 | |
Gene Name | Yp1 | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 439 | |
Subcellular Localization | Secreted. | |
Protein Description | Vitellogenin is the major yolk protein of eggs where it is used as a food source during embryogenesis.. | |
Protein Sequence | MNPMRVLSLLACLAVAALAKPNGRMDNSVNQALKPSQWLSGSQLEAIPALDDFTIERLENMNLERGAELLQQVYHLSQIHHNVEPNYVPSGIQVYVPKPNGDKTVAPLNEMIQRLKQKQNFGEDEVTIIVTGLPQTSETVKKATRKLVQAYMQRYNLQQQRQHGKNGNQDYQDQSNEQRKNQRTSSEEDYSEEVKNAKTQSGDIIVIDLGSKLNTYERYAMLDIEKTGAKIGKWIVQMVNELDMPFDTIHLIGQNVGAHVAGAAAQEFTRLTGHKLRRVTGLDPSKIVAKSKNTLTGLARGDAEFVDAIHTSVYGMGTPIRSGDVDFYPNGPAAGVPGASNVVEAAMRATRYFAESVRPGNERSFPAVPANSLQQYKQNDGFGKRAYMGIDTAHDLEGDYILQVNPKSPFGRNAPAQKQSSYHGVHQAWNTNQDSKDYQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | PNGRMDNSVNQALKP CCCCCCCHHHHCCCH | 20.41 | 30478224 | |
40 | Phosphorylation | LKPSQWLSGSQLEAI CCHHHCCCHHHCCCC | 33.18 | 30478224 | |
171 | Phosphorylation | GKNGNQDYQDQSNEQ CCCCCHHHHHHHHHH | 12.29 | 28490779 | |
175 | Phosphorylation | NQDYQDQSNEQRKNQ CHHHHHHHHHHHHHH | 51.10 | 28490779 | |
184 | Phosphorylation | EQRKNQRTSSEEDYS HHHHHHCCCCHHHHH | 27.17 | 28490779 | |
185 | Phosphorylation | QRKNQRTSSEEDYSE HHHHHCCCCHHHHHH | 37.63 | 28490779 | |
186 | Phosphorylation | RKNQRTSSEEDYSEE HHHHCCCCHHHHHHH | 44.38 | 28490779 | |
190 | Phosphorylation | RTSSEEDYSEEVKNA CCCCHHHHHHHHHHH | 22.66 | 28490779 | |
191 | Phosphorylation | TSSEEDYSEEVKNAK CCCHHHHHHHHHHHC | 39.33 | 28490779 | |
291 | Phosphorylation | PSKIVAKSKNTLTGL HHHHEEECCCCCHHH | 22.77 | 22817900 | |
356 | Phosphorylation | ATRYFAESVRPGNER HHHHHHHHCCCCCCC | 21.72 | 22817900 | |
431 | Phosphorylation | GVHQAWNTNQDSKDY CHHHCCCCCCCCCCC | 24.45 | 30478224 | |
435 | Phosphorylation | AWNTNQDSKDYQ--- CCCCCCCCCCCC--- | 20.05 | 30478224 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of VIT1_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of VIT1_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of VIT1_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SRP68_DROME | Srp68 | physical | 14605208 | |
MNB_DROME | mnb | physical | 14605208 | |
VIT3_DROME | Yp3 | physical | 22036573 | |
VIT2_DROME | Yp2 | physical | 22036573 | |
APLP_DROME | Rfabg | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Phosphorylation | |
Reference | PubMed |
"Phosphoproteome analysis of Drosophila melanogaster embryos."; Zhai B., Villen J., Beausoleil S.A., Mintseris J., Gygi S.P.; J. Proteome Res. 7:1675-1682(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-171; SER-175; SER-185;SER-186; TYR-190; SER-191 AND SER-435, AND MASS SPECTROMETRY. |