L2CC_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: L2CC_DROME
• UniProt AC: P24156
• Protein Name: Protein l(2)37Cc
• Gene Name: l(2)37Cc
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 276
• Protein Description: Required for larval metabolism or for the progression of the larva into a pupa..
• Protein Sequence: MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPSTIAQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
195	Acetylation	VAQQEAEKARFVVEK HHHHHHHHHHHHHHH	52.49	21791702
202	Acetylation	KARFVVEKAEQQKLA HHHHHHHHHHHHHHH	45.68	21791702

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of L2CC_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of L2CC_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of L2CC_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RAB26_DROME	Rab26	physical	14605208
VDAC_DROME	porin	physical	22036573
OST48_DROME	Ost48	physical	22036573
PCNA_DROME	PCNA	physical	22036573
PDI_DROME	Pdi	physical	22036573
PELI_DROME	Pli	physical	22036573
OLA1_DROME	CG1354	physical	22036573

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.