UniProt ID | L2CC_DROME | |
---|---|---|
UniProt AC | P24156 | |
Protein Name | Protein l(2)37Cc | |
Gene Name | l(2)37Cc | |
Organism | Drosophila melanogaster (Fruit fly). | |
Sequence Length | 276 | |
Subcellular Localization | ||
Protein Description | Required for larval metabolism or for the progression of the larva into a pupa.. | |
Protein Sequence | MAAQFFNRIGQMGLGVAVLGGVVNSALYNVEGGHRAVIFDRFTGIKENVVGEGTHFFIPWVQRPIIFDIRSQPRNVPVITGSKDLQNVNITLRILYRPIPDQLPKIYTILGQDYDERVLPSIAPEVLKAVVAQFDAGELITQREMVSQRVSQELTVRAKQFGFILDDISLTHLTFGREFTLAVEMKQVAQQEAEKARFVVEKAEQQKLASIISAEGDAEAAGLLAKSFGEAGDGLVELRRIEAAEDIAYQLSRSRGVAYLPSGQSTLLNLPSTIAQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of L2CC_DROME !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of L2CC_DROME !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of L2CC_DROME !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RAB26_DROME | Rab26 | physical | 14605208 | |
VDAC_DROME | porin | physical | 22036573 | |
OST48_DROME | Ost48 | physical | 22036573 | |
PCNA_DROME | PCNA | physical | 22036573 | |
PDI_DROME | Pdi | physical | 22036573 | |
PELI_DROME | Pli | physical | 22036573 | |
OLA1_DROME | CG1354 | physical | 22036573 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...