OLA1_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OLA1_DROME
• UniProt AC: Q8SWU7
• Protein Name: Obg-like ATPase 1 {ECO:0000255|HAMAP-Rule:MF_03167}
• Gene Name: CG1354
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 397
• Subcellular Localization: Cytoplasm .
• Protein Description: Hydrolyzes ATP, and can also hydrolyze GTP with lower efficiency. Has lower affinity for GTP..
• Protein Sequence: MPPKKHDEPERKPLIGRIGTNLRIGIVGVPNVGKSTFFNVLTQSAAPAENFPFCTIKPNESRVPVPDERFDYLVEYHKPASVVPAYLNVVDIAGLVKGAAEGQGLGNDFLSHISACDAIFHLCRAFEDPDVTHVEGEVDPVRDLEIISEELRLKDEENLLKNLDKLEKVVARGGDKKLKPEYDSMLKIKDILIDQKRHLRFEDWNAHDIEALNKYLFLTSKPVIYLVNLSDKDFIRKKNKWLPKIKEWIDKNDPGALLIPFSGAFEHQLTEKDELERKAYETETKCKSMLEKIVVTGYKGLQLEYFFTAGPDEVKAWTIQKGTKAPQAAGRIHTDFEKGFIMAEVMHFEDFKAEGSEANAKAAGKYRQQGRNYTVEDGDIIFFKFNAGAGLKDAKKK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
132	Phosphorylation	AFEDPDVTHVEGEVD HCCCCCCCEEECCCC		17372656

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OLA1_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OLA1_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OLA1_DROME !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.