| UniProt ID | KLK2_HUMAN | |
|---|---|---|
| UniProt AC | P20151 | |
| Protein Name | Kallikrein-2 | |
| Gene Name | KLK2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 261 | |
| Subcellular Localization | ||
| Protein Description | Glandular kallikreins cleave Met-Lys and Arg-Ser bonds in kininogen to release Lys-bradykinin.. | |
| Protein Sequence | MWDLVLSIALSVGCTGAVPLIQSRIVGGWECEKHSQPWQVAVYSHGWAHCGGVLVHPQWVLTAAHCLKKNSQVWLGRHNLFEPEDTGQRVPVSHSFPHPLYNMSLLKHQSLRPDEDSSHDLMLLRLSEPAKITDVVKVLGLPTQEPALGTTCYASGWGSIEPEEFLRPRSLQCVSLHLLSNDMCARAYSEKVTEFMLCAGLWTGGKDTCGGDSGGPLVCNGVLQGITSWGPEPCALPEKPAVYTKVVHYRKWIKDTIAANP | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 101 | Phosphorylation | HSFPHPLYNMSLLKH CCCCCCCCCHHHHHC | 17.17 | 27251275 | |
| 102 | N-linked_Glycosylation | SFPHPLYNMSLLKHQ CCCCCCCCHHHHHCC | 22.65 | UniProtKB CARBOHYD | |
| 104 | Phosphorylation | PHPLYNMSLLKHQSL CCCCCCHHHHHCCCC | 27.23 | 24719451 | |
| 203 (in isoform 2) | Phosphorylation | - | 40.89 | - | |
| 203 | Phosphorylation | MLCAGLWTGGKDTCG HHEECCCCCCCCCCC | 40.89 | - | |
| 208 (in isoform 2) | Phosphorylation | - | 19.28 | - | |
| 208 | Phosphorylation | LWTGGKDTCGGDSGG CCCCCCCCCCCCCCC | 19.28 | - | |
| 216 (in isoform 2) | Phosphorylation | - | 25.75 | - | |
| 249 | Phosphorylation | VYTKVVHYRKWIKDT EEEEHHHHHHHHHHH | 11.41 | 18083107 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of KLK2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of KLK2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of KLK2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A2AP_HUMAN | SERPINF2 | physical | 9428387 | |
| AACT_HUMAN | SERPINA3 | physical | 9428387 | |
| IPSP_HUMAN | SERPINA5 | physical | 9016396 | |
| SPB6_HUMAN | SERPINB6 | physical | 11745444 | |
| A4_HUMAN | APP | physical | 21832049 | |
| ATS1_HUMAN | ADAMTS1 | physical | 26186194 | |
| SPB6_HUMAN | SERPINB6 | physical | 26186194 | |
| GDN_HUMAN | SERPINE2 | physical | 26186194 | |
| APLP2_HUMAN | APLP2 | physical | 26186194 | |
| GSLG1_HUMAN | GLG1 | physical | 26186194 | |
| GDN_HUMAN | SERPINE2 | physical | 28514442 | |
| APLP2_HUMAN | APLP2 | physical | 28514442 | |
| GSLG1_HUMAN | GLG1 | physical | 28514442 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
