dbPTM

HXB7_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	HXB7_HUMAN
UniProt AC	P09629
Protein Name	Homeobox protein Hox-B7
Gene Name	HOXB7
Organism	Homo sapiens (Human).
Sequence Length	217
Subcellular Localization	Nucleus.
Protein Description	Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis..
Protein Sequence	MSSLYYANTLFSKYPASSSVFATGAFPEQTSCAFASNPQRPGYGAGSGASFAASMQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAAESNFRIYPWMRSSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKENKTAGPGTTGQDRAEAEEEEEE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MSSLYYANTLFSK --CCCCEEHHHHHHC	9.92	-
12	Phosphorylation	YYANTLFSKYPASSS EEHHHHHHCCCCCCC	34.10	24719451
19	Phosphorylation	SKYPASSSVFATGAF HCCCCCCCCEECCCC	20.82	22468782
23	Phosphorylation	ASSSVFATGAFPEQT CCCCCEECCCCCCCC	19.99	22468782
116	Phosphorylation	GAKEQRDSDLAAESN CCCCHHHCHHHHHCC	36.39	28985074
132	Phosphorylation	RIYPWMRSSGTDRKR EEEHHHHCCCCCCCC	19.60	11290787
133	Phosphorylation	IYPWMRSSGTDRKRG EEHHHHCCCCCCCCC	35.03	11290787
149	Phosphorylation	QTYTRYQTLELEKEF EEECEEEEHHHHHHH	17.17	29449344
158	Phosphorylation	ELEKEFHYNRYLTRR HHHHHHHHHHHHHHH	13.47	29449344
160	Methylation	EKEFHYNRYLTRRRR HHHHHHHHHHHHHHH	22.22	-
161	Phosphorylation	KEFHYNRYLTRRRRI HHHHHHHHHHHHHHH	14.59	29449344
163	Phosphorylation	FHYNRYLTRRRRIEI HHHHHHHHHHHHHHH	17.13	29449344
191	Ubiquitination	WFQNRRMKWKKENKT HHHCCCCCEECCCCC	54.79	17203973
193	Ubiquitination	QNRRMKWKKENKTAG HCCCCCEECCCCCCC	44.70	17203973
203	Phosphorylation	NKTAGPGTTGQDRAE CCCCCCCCCCHHHHH	30.77	11290787
204	Phosphorylation	KTAGPGTTGQDRAEA CCCCCCCCCHHHHHH	38.47	11290787

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
132	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
133	S	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
133	S	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
133	S	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM
203	T	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
204	T	Phosphorylation	Kinase	CSNK2A1	P68400	GPS
204	T	Phosphorylation	Kinase	CK2-FAMILY	-	GPS
204	T	Phosphorylation	Kinase	CK2_GROUP	-	PhosphoELM

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of HXB7_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of HXB7_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CBP_HUMAN	CREBBP	physical	11585930
PARP1_HUMAN	PARP1	physical	17308091
XRCC5_HUMAN	XRCC5	physical	17308091
XRCC6_HUMAN	XRCC6	physical	17308091
PRKDC_HUMAN	PRKDC	physical	17308091
A4_HUMAN	APP	physical	21832049
IRAK3_HUMAN	IRAK3	physical	21988832
UBR3_HUMAN	UBR3	physical	26186194
IMDH1_HUMAN	IMPDH1	physical	26186194
UBR3_HUMAN	UBR3	physical	28514442

Drug and Disease Associations

Kegg Disease
There are no disease associations of PTM sites.
OMIM Disease
There are no disease associations of PTM sites.
Kegg Drug
There are no disease associations of PTM sites.
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of HXB7_HUMAN

Related Literatures of Post-Translational Modification

Ubiquitylation
Reference	PubMed
"The proteomic reactor facilitates the analysis of affinity-purifiedproteins by mass spectrometry: application for identifyingubiquitinated proteins in human cells."; Vasilescu J., Zweitzig D.R., Denis N.J., Smith J.C., Ethier M.,Haines D.S., Figeys D.; J. Proteome Res. 6:298-305(2007). Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-191 AND LYS-193, AND MASSSPECTROMETRY.	17203973 [Abstract]