HSPB6_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HSPB6_HUMAN
• UniProt AC: O14558
• Protein Name: Heat shock protein beta-6
• Gene Name: HSPB6
• Organism: Homo sapiens (Human).
• Sequence Length: 160
• Subcellular Localization: Cytoplasm . Nucleus . Secreted . Translocates to nuclear foci during heat shock.
• Protein Description: Small heat shock protein which functions as a molecular chaperone probably maintaining denatured proteins in a folding-competent state. Seems to have versatile functions in various biological processes. Plays a role in regulating muscle function such as smooth muscle vasorelaxation and cardiac myocyte contractility. May regulate myocardial angiogenesis implicating KDR. Overexpression mediates cardioprotection and angiogenesis after induced damage. Stabilizes monomeric YWHAZ thereby supporting YWHAZ chaperone-like activity..
• Protein Sequence: MEIPVPVQPSWLRRASAPLPGLSAPGRLFDQRFGEGLLEAELAALCPTTLAPYYLRAPSVALPVAQVPTDPGHFSVLLDVKHFSPEEIAVKVVGEHVEVHARHEERPDEHGFVAREFHRRYRLPPGVDPAAVTSALSPEGVLSIQAAPASAQAPPPAAAK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
16	Phosphorylation	PSWLRRASAPLPGLS HHHHHHCCCCCCCCC	28.71	12133854
23	Phosphorylation	SAPLPGLSAPGRLFD CCCCCCCCCCCCHHC	38.03	23403867
59	Phosphorylation	PYYLRAPSVALPVAQ HHHHCCCCCEEEEEE	21.02	26699800
66	Deamidation	SVALPVAQVPTDPGH CCEEEEEECCCCCCC	41.79	-
84	Phosphorylation	LLDVKHFSPEEIAVK EEECCCCCHHHHEEE	30.99	23312004
150	Phosphorylation	SIQAAPASAQAPPPA EEEECCCCCCCCCCC	21.61	26657352
160	Acetylation	APPPAAAK------- CCCCCCCC-------	57.03	21803775

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
16	S	Phosphorylation	Kinase	PRKACA	P17612	GPS
16	S	Phosphorylation	Kinase	PKACA	P05132	PSP
16	S	Phosphorylation	Kinase	PKG1	P00516	PSP
16	S	Phosphorylation	Kinase	PRKG1	P0C605	GPS
16	S	Phosphorylation	Kinase	PRKD1	Q15139	PSP
16	S	Phosphorylation	Kinase	PKA	-	Uniprot

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
16	S	Phosphorylation	Phosphorylated at Ser-16 by PKA and probably PKD1K; required to protect cardiomyocytes from apoptosis.	21334344

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HSPB6_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MAP1B_HUMAN	MAP1B	physical	26186194
FBX11_HUMAN	FBXO11	physical	26186194
HSPB1_HUMAN	HSPB1	physical	26186194
UBR3_HUMAN	UBR3	physical	26186194
PNMA2_HUMAN	PNMA2	physical	26186194
BAG3_HUMAN	BAG3	physical	26186194
UBR3_HUMAN	UBR3	physical	28514442
HSPB1_HUMAN	HSPB1	physical	28514442
ATG4A_HUMAN	ATG4A	physical	28514442
PNMA2_HUMAN	PNMA2	physical	28514442
MAP1B_HUMAN	MAP1B	physical	28514442
BAG3_HUMAN	BAG3	physical	28514442
FBX11_HUMAN	FBXO11	physical	28514442

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.