HSP16_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: HSP16_SCHPO
• UniProt AC: O14368
• Protein Name: Heat shock protein 16
• Gene Name: hsp16
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 143
• Subcellular Localization: Cytoplasm . Nucleus .
• Protein Sequence: MSLQPFFGFPPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
36	Phosphorylation	NQIPGELSPSIDVHE CCCCCCCCCCEEEEC	16.58	28889911
99	Phosphorylation	WSERRFGSFSRTITI HHHHCCCCCEEEEEE	19.82	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of HSP16_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of HSP16_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of HSP16_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RFP1_SCHPO	rfp1	physical	11452028
HSP16_SCHPO	hsp16	physical	11452028
MU190_SCHPO	mug190	physical	11452028
PMT3_SCHPO	pmt3	physical	11452028
TUP12_SCHPO	tup12	physical	11452028
RAD18_SCHPO	rhp18	physical	11452028
EF3_SCHPO	tef3	physical	11452028
PFL5_SCHPO	pfl5	physical	11452028
A4_HUMAN	APP	physical	23261462
HSP16_SCHPO	hsp16	physical	23273429
SKH1_SCHPO	pek1	physical	23695164
HSP16_SCHPO	hsp16	physical	23695164
HSP16_SCHPO	hsp16	physical	26771498
SKH1_SCHPO	pek1	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.