UniProt ID | HSP16_SCHPO | |
---|---|---|
UniProt AC | O14368 | |
Protein Name | Heat shock protein 16 | |
Gene Name | hsp16 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 143 | |
Subcellular Localization | Cytoplasm . Nucleus . | |
Protein Description | ||
Protein Sequence | MSLQPFFGFPPTVNDLFSDFVSYSPRLNNQIPGELSPSIDVHEGKDTVSVDVELPGVKKEDVQVHYDSGKLTISGEVVNERKNESTEGNQRWSERRFGSFSRTITIPAKIDADRIEANFSNGLLTVTLPKVEKSQTKKQIAIK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HSP16_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HSP16_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HSP16_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
RFP1_SCHPO | rfp1 | physical | 11452028 | |
HSP16_SCHPO | hsp16 | physical | 11452028 | |
MU190_SCHPO | mug190 | physical | 11452028 | |
PMT3_SCHPO | pmt3 | physical | 11452028 | |
TUP12_SCHPO | tup12 | physical | 11452028 | |
RAD18_SCHPO | rhp18 | physical | 11452028 | |
EF3_SCHPO | tef3 | physical | 11452028 | |
PFL5_SCHPO | pfl5 | physical | 11452028 | |
A4_HUMAN | APP | physical | 23261462 | |
HSP16_SCHPO | hsp16 | physical | 23273429 | |
SKH1_SCHPO | pek1 | physical | 23695164 | |
HSP16_SCHPO | hsp16 | physical | 23695164 | |
HSP16_SCHPO | hsp16 | physical | 26771498 | |
SKH1_SCHPO | pek1 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...