UniProt ID | HRSL4_HUMAN | |
---|---|---|
UniProt AC | Q9UL19 | |
Protein Name | Retinoic acid receptor responder protein 3 | |
Gene Name | RARRES3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 164 | |
Subcellular Localization |
Membrane Single-pass membrane protein. |
|
Protein Description | Exhibits PLA1/2 activity, catalyzing the calcium-independent hydrolysis of acyl groups in various phosphotidylcholines (PC) and phosphatidylethanolamine (PE). For most substrates, PLA1 activity is much higher than PLA2 activity. N- and O-acylation activity is hardly detectable.. | |
Protein Sequence | MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|
---|---|---|---|---|---|---|
Oops, there are no PTM records of HRSL4_HUMAN !! |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of HRSL4_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of HRSL4_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of HRSL4_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TRI25_HUMAN | TRIM25 | physical | 18948594 | |
TNAP3_HUMAN | TNFAIP3 | physical | 16306043 | |
HS90A_HUMAN | HSP90AA1 | physical | 19234166 | |
MAVS_HUMAN | MAVS | physical | 21203974 | |
TRAT1_HUMAN | TRAT1 | physical | 22607805 | |
1433E_HUMAN | YWHAE | physical | 22607805 | |
MAVS_HUMAN | MAVS | physical | 19734229 | |
PTGDS_HUMAN | PTGDS | physical | 22960220 | |
SGTA_HUMAN | SGTA | physical | 25416956 | |
SDC4_HUMAN | SDC4 | physical | 27279133 | |
RN123_HUMAN | RNF123 | physical | 27312109 | |
MAVS_HUMAN | MAVS | physical | 27312109 | |
RN135_HUMAN | RNF135 | physical | 27312109 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...