UniProt ID | GON1_HUMAN | |
---|---|---|
UniProt AC | P01148 | |
Protein Name | Progonadoliberin-1 | |
Gene Name | GNRH1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 92 | |
Subcellular Localization | Secreted. | |
Protein Description | Stimulates the secretion of gonadotropins; it stimulates the secretion of both luteinizing and follicle-stimulating hormones.. | |
Protein Sequence | MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRSPLRDLKGALESLIEEETGQKKI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 | Pyrrolidone_carboxylic_acid | CVEGCSSQHWSYGLR HHHHHHCCCCCCCCC | 26.27 | - | |
24 | Pyrrolidone_carboxylic_acid | CVEGCSSQHWSYGLR HHHHHHCCCCCCCCC | 26.27 | 6760865 | |
24 | Pyrrolidone_carboxylic_acid | CVEGCSSQHWSYGLR HHHHHHCCCCCCCCC | 26.27 | 6760865 | |
33 | Glycine amide | WSYGLRPGGKRDAEN CCCCCCCCCCCHHHH | 48.06 | - | |
33 | Amidation | WSYGLRPGGKRDAEN CCCCCCCCCCCHHHH | 48.06 | 6760865 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GON1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GON1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GON1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTX1_HUMAN | MTX1 | physical | 28514442 | |
TRI68_HUMAN | TRIM68 | physical | 28514442 | |
MASU1_HUMAN | MALSU1 | physical | 28514442 | |
EMC8_HUMAN | EMC8 | physical | 28514442 | |
EMC3_HUMAN | EMC3 | physical | 28514442 | |
EMC4_HUMAN | EMC4 | physical | 28514442 | |
GRP78_HUMAN | HSPA5 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
OMIM Disease | ||||||
614841 | Hypogonadotropic hypogonadism 12 with or without anosmia (HH12) | |||||
Kegg Drug | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Amidation | |
Reference | PubMed |
"The chemical identity of the immunoreactive LHRH-like peptidebiosynthesized in the human placenta."; Tan L., Rousseau P.; Biochem. Biophys. Res. Commun. 109:1061-1071(1982). Cited for: PROTEIN SEQUENCE OF 24-33. | |
Pyrrolidone carboxylic acid | |
Reference | PubMed |
"The chemical identity of the immunoreactive LHRH-like peptidebiosynthesized in the human placenta."; Tan L., Rousseau P.; Biochem. Biophys. Res. Commun. 109:1061-1071(1982). Cited for: PROTEIN SEQUENCE OF 24-33. |