UniProt ID | GET3_SCHPO | |
---|---|---|
UniProt AC | Q9P7F8 | |
Protein Name | ATPase get3 {ECO:0000255|HAMAP-Rule:MF_03112} | |
Gene Name | get3 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 329 | |
Subcellular Localization | Cytoplasm . Endoplasmic reticulum . Nucleus . | |
Protein Description | ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting.. | |
Protein Sequence | MSFDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNLSDAFGTKFGKDARKVPGFDNLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFTIPGIDEALAFAEILKQIKSMEFDCVIFDTAPTGHTLRFLNFPTVLEKALGKLGGLSSRFGPMINQMGSIMGVNANEQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQELTSYEIDTHNIVVNQLLLDPNTTCPQCMARRKMQQKYLAQIEELYEDFHVVKVPQVPAEVRGTEALKSFSEMLVKPYVYPTSGKE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MSFDPLPGT ------CCCCCCCCC | 38.05 | 21712547 | |
48 | Phosphorylation | IQMSKVRSSVLLIST HHHHHCCCEEEEEEC | 27.99 | 25720772 | |
325 | Phosphorylation | VKPYVYPTSGKE--- CCCEECCCCCCC--- | 32.21 | 25720772 | |
326 | Phosphorylation | KPYVYPTSGKE---- CCEECCCCCCC---- | 43.28 | 25720772 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of GET3_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of GET3_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of GET3_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SSN3_SCHPO | srb10 | genetic | 22681890 | |
CGM2_SCHPO | mcs2 | genetic | 22681890 | |
MUG61_SCHPO | man1 | physical | 23695164 | |
PTH2_SCHPO | SPAC19A8.14 | physical | 23695164 | |
SYP1_SCHPO | syp1 | physical | 23695164 | |
MUG61_SCHPO | man1 | physical | 26771498 | |
PTH2_SCHPO | SPAC19A8.14 | physical | 26771498 | |
GRP78_SCHPO | bip1 | physical | 26771498 | |
YA71_SCHPO | SPAC24H6.01c | physical | 26771498 | |
DAP1_SCHPO | dap1 | physical | 26771498 | |
CALX_SCHPO | cnx1 | physical | 26771498 | |
YKI4_SCHPO | SPAC630.04c | physical | 26771498 | |
TOM20_SCHPO | tom20 | physical | 26771498 | |
PEX14_SCHPO | pex14 | physical | 26771498 | |
NCPR_SCHPO | ccr1 | physical | 26771498 | |
MTXL_SCHPO | SPBC409.19c | physical | 26771498 | |
SYP1_SCHPO | syp1 | physical | 26771498 | |
PPIB_SCHPO | cyp4 | physical | 26771498 | |
GET4_SCHPO | get4 | physical | 26771498 | |
YCZ2_SCHPO | SPCC970.02 | physical | 26771498 | |
AREH2_SCHPO | are2 | physical | 26771498 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...