GET3_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: GET3_SCHPO
• UniProt AC: Q9P7F8
• Protein Name: ATPase get3 {ECO:0000255|HAMAP-Rule:MF_03112}
• Gene Name: get3
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 329
• Subcellular Localization: Cytoplasm . Endoplasmic reticulum . Nucleus .
• Protein Description: ATPase required for the post-translational delivery of tail-anchored (TA) proteins to the endoplasmic reticulum. Recognizes and selectively binds the transmembrane domain of TA proteins in the cytosol. This complex then targets to the endoplasmic reticulum by membrane-bound receptors, where the tail-anchored protein is released for insertion. This process is regulated by ATP binding and hydrolysis. ATP binding drives the homodimer towards the closed dimer state, facilitating recognition of newly synthesized TA membrane proteins. ATP hydrolysis is required for insertion. Subsequently, the homodimer reverts towards the open dimer state, lowering its affinity for the membrane-bound receptor, and returning it to the cytosol to initiate a new round of targeting..
• Protein Sequence: MSFDPLPGTLENLLEQTSLKWIFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPAHNLSDAFGTKFGKDARKVPGFDNLSAMEIDPNLSIQEMTEQADQQNPNNPLSGMMQDLAFTIPGIDEALAFAEILKQIKSMEFDCVIFDTAPTGHTLRFLNFPTVLEKALGKLGGLSSRFGPMINQMGSIMGVNANEQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQELTSYEIDTHNIVVNQLLLDPNTTCPQCMARRKMQQKYLAQIEELYEDFHVVKVPQVPAEVRGTEALKSFSEMLVKPYVYPTSGKE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSFDPLPGT ------CCCCCCCCC	38.05	21712547
48	Phosphorylation	IQMSKVRSSVLLIST HHHHHCCCEEEEEEC	27.99	25720772
325	Phosphorylation	VKPYVYPTSGKE--- CCCEECCCCCCC---	32.21	25720772
326	Phosphorylation	KPYVYPTSGKE---- CCEECCCCCCC----	43.28	25720772

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of GET3_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of GET3_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of GET3_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SSN3_SCHPO	srb10	genetic	22681890
CGM2_SCHPO	mcs2	genetic	22681890
MUG61_SCHPO	man1	physical	23695164
PTH2_SCHPO	SPAC19A8.14	physical	23695164
SYP1_SCHPO	syp1	physical	23695164
MUG61_SCHPO	man1	physical	26771498
PTH2_SCHPO	SPAC19A8.14	physical	26771498
GRP78_SCHPO	bip1	physical	26771498
YA71_SCHPO	SPAC24H6.01c	physical	26771498
DAP1_SCHPO	dap1	physical	26771498
CALX_SCHPO	cnx1	physical	26771498
YKI4_SCHPO	SPAC630.04c	physical	26771498
TOM20_SCHPO	tom20	physical	26771498
PEX14_SCHPO	pex14	physical	26771498
NCPR_SCHPO	ccr1	physical	26771498
MTXL_SCHPO	SPBC409.19c	physical	26771498
SYP1_SCHPO	syp1	physical	26771498
PPIB_SCHPO	cyp4	physical	26771498
GET4_SCHPO	get4	physical	26771498
YCZ2_SCHPO	SPCC970.02	physical	26771498
AREH2_SCHPO	are2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.