TOM20_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: TOM20_SCHPO
• UniProt AC: O14225
• Protein Name: Mitochondrial import receptor subunit tom20
• Gene Name: tom20
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 152
• Subcellular Localization: Mitochondrion outer membrane ; Single-pass membrane protein .
• Protein Description: Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with tom22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the translocation pore (By similarity)..
• Protein Sequence: MRRSVIIGSLLATAAVGYAIYFDYKRRNDPHFRKTLKRRYKKVHEAKKQEEKLATKKFDITVEEALQVVASTPVPSSAEEKELFFMQQVARGEQLFQQQPDNIKESAACFYSALKVYPQPVELFAIYERTVPEPIMNLLRAMQAKESIPSVE

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of TOM20_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of TOM20_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of TOM20_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of TOM20_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
YGNB_SCHPO	nap2	physical	26771498

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.