dbPTM

PTH2_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PTH2_SCHPO
UniProt AC	O13830
Protein Name	Probable peptidyl-tRNA hydrolase 2
Gene Name	SPAC19A8.14
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	205
Subcellular Localization
Protein Description	The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis..
Protein Sequence	MKVPFVNFMISSFPAAVLVGAVVGFMIGRKYSVADASRGYSSKNANKASNPEKESPVSVSNDEDSESETELLDMLKGNSSLAALALAEGQTKMVLVVRTDLGMTKGKIAAQCAHAALACYKIASAVDPDLVRIWENAGQAKITLQAQTEETLELLQAQAMSLGLCARVIHDAGRTQIASGSATVLGIGPGPVSVINEVTGSLKLF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
55	Phosphorylation	ASNPEKESPVSVSND CCCCCCCCCCCCCCC	41.49	21712547
58	Phosphorylation	PEKESPVSVSNDEDS CCCCCCCCCCCCCCC	24.18	25720772
60	Phosphorylation	KESPVSVSNDEDSES CCCCCCCCCCCCCCC	30.93	28889911
65	Phosphorylation	SVSNDEDSESETELL CCCCCCCCCCHHHHH	40.76	28889911
67	Phosphorylation	SNDEDSESETELLDM CCCCCCCCHHHHHHH	54.49	24763107
69	Phosphorylation	DEDSESETELLDMLK CCCCCCHHHHHHHHC	41.01	21712547
79	Phosphorylation	LDMLKGNSSLAALAL HHHHCCCHHHHHHHH	35.08	28889911
80	Phosphorylation	DMLKGNSSLAALALA HHHCCCHHHHHHHHH	26.48	28889911

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PTH2_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PTH2_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PTH2_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PTH2_SCHPO !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PTH2_SCHPO

Related Literatures of Post-Translational Modification

Phosphorylation
Reference	PubMed
"Phosphoproteome analysis of fission yeast."; Wilson-Grady J.T., Villen J., Gygi S.P.; J. Proteome Res. 7:1088-1097(2008). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-65 AND SER-79, AND MASSSPECTROMETRY.	18257517 [Abstract]