UniProt ID | PTH2_SCHPO | |
---|---|---|
UniProt AC | O13830 | |
Protein Name | Probable peptidyl-tRNA hydrolase 2 | |
Gene Name | SPAC19A8.14 | |
Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
Sequence Length | 205 | |
Subcellular Localization | ||
Protein Description | The natural substrate for this enzyme may be peptidyl-tRNAs which drop off the ribosome during protein synthesis.. | |
Protein Sequence | MKVPFVNFMISSFPAAVLVGAVVGFMIGRKYSVADASRGYSSKNANKASNPEKESPVSVSNDEDSESETELLDMLKGNSSLAALALAEGQTKMVLVVRTDLGMTKGKIAAQCAHAALACYKIASAVDPDLVRIWENAGQAKITLQAQTEETLELLQAQAMSLGLCARVIHDAGRTQIASGSATVLGIGPGPVSVINEVTGSLKLF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
55 | Phosphorylation | ASNPEKESPVSVSND CCCCCCCCCCCCCCC | 41.49 | 21712547 | |
58 | Phosphorylation | PEKESPVSVSNDEDS CCCCCCCCCCCCCCC | 24.18 | 25720772 | |
60 | Phosphorylation | KESPVSVSNDEDSES CCCCCCCCCCCCCCC | 30.93 | 28889911 | |
65 | Phosphorylation | SVSNDEDSESETELL CCCCCCCCCCHHHHH | 40.76 | 28889911 | |
67 | Phosphorylation | SNDEDSESETELLDM CCCCCCCCHHHHHHH | 54.49 | 24763107 | |
69 | Phosphorylation | DEDSESETELLDMLK CCCCCCHHHHHHHHC | 41.01 | 21712547 | |
79 | Phosphorylation | LDMLKGNSSLAALAL HHHHCCCHHHHHHHH | 35.08 | 28889911 | |
80 | Phosphorylation | DMLKGNSSLAALALA HHHCCCHHHHHHHHH | 26.48 | 28889911 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PTH2_SCHPO !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PTH2_SCHPO !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PTH2_SCHPO !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PTH2_SCHPO !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...