UniProt ID | FAM3B_HUMAN | |
---|---|---|
UniProt AC | P58499 | |
Protein Name | Protein FAM3B | |
Gene Name | FAM3B | |
Organism | Homo sapiens (Human). | |
Sequence Length | 235 | |
Subcellular Localization | Secreted. Present in insulin secretory granules and likely cosecreted with insulin. Localized in discrete vesicular and perinuclear structure. | |
Protein Description | Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.. | |
Protein Sequence | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
43 | Phosphorylation | PLSSAAYSIRSIGER CCCCCCCCCCCCCCC | 13.55 | 24719451 | |
80 | Phosphorylation | TYAYRLLSGGGRSKY CHHHHHHCCCCCCCE | 39.73 | - | |
116 | Phosphorylation | INIAIVNYVTGNVTA CEEEEEEECCCCEEE | 6.62 | 27067055 | |
120 | N-linked_Glycosylation | IVNYVTGNVTATRCF EEEECCCCEEEEEEE | 20.71 | UniProtKB CARBOHYD | |
186 | Phosphorylation | IRNMKFRSSWVFIAA HHCCCCCCCEEEEEE | 31.52 | 22210691 | |
187 | Phosphorylation | RNMKFRSSWVFIAAK HCCCCCCCEEEEEEC | 24.01 | 22210691 | |
200 | Phosphorylation | AKGLELPSEIQREKI ECCCCCCHHHHHHHC | 61.01 | 22210691 | |
208 | N-linked_Glycosylation | EIQREKINHSDAKNN HHHHHHCCCHHHCCC | 39.41 | UniProtKB CARBOHYD |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAM3B_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAM3B_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAM3B_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
A4_HUMAN | APP | physical | 21832049 | |
TM9S4_HUMAN | TM9SF4 | physical | 28514442 | |
ITPA_HUMAN | ITPA | physical | 28514442 | |
CAR19_HUMAN | C9orf89 | physical | 28514442 | |
GNPTA_HUMAN | GNPTAB | physical | 28514442 | |
LRP5_HUMAN | LRP5 | physical | 28514442 | |
ANR46_HUMAN | ANKRD46 | physical | 28514442 | |
CBWD1_HUMAN | CBWD1 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...