| UniProt ID | FAM3B_HUMAN | |
|---|---|---|
| UniProt AC | P58499 | |
| Protein Name | Protein FAM3B | |
| Gene Name | FAM3B | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 235 | |
| Subcellular Localization | Secreted. Present in insulin secretory granules and likely cosecreted with insulin. Localized in discrete vesicular and perinuclear structure. | |
| Protein Description | Induces apoptosis of alpha and beta cells in a dose- and time-dependent manner.. | |
| Protein Sequence | MRPLAGGLLKVVFVVFASLCAWYSGYLLAELIPDAPLSSAAYSIRSIGERPVLKAPVPKRQKCDHWTPCPSDTYAYRLLSGGGRSKYAKICFEDNLLMGEQLGNVARGINIAIVNYVTGNVTATRCFDMYEGDNSGPMTKFIQSAAPKSLLFMVTYDDGSTRLNNDAKNAIEALGSKEIRNMKFRSSWVFIAAKGLELPSEIQREKINHSDAKNNRYSGWPAEIQIEGCIPKERS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 43 | Phosphorylation | PLSSAAYSIRSIGER CCCCCCCCCCCCCCC | 13.55 | 24719451 | |
| 80 | Phosphorylation | TYAYRLLSGGGRSKY CHHHHHHCCCCCCCE | 39.73 | - | |
| 116 | Phosphorylation | INIAIVNYVTGNVTA CEEEEEEECCCCEEE | 6.62 | 27067055 | |
| 120 | N-linked_Glycosylation | IVNYVTGNVTATRCF EEEECCCCEEEEEEE | 20.71 | UniProtKB CARBOHYD | |
| 186 | Phosphorylation | IRNMKFRSSWVFIAA HHCCCCCCCEEEEEE | 31.52 | 22210691 | |
| 187 | Phosphorylation | RNMKFRSSWVFIAAK HCCCCCCCEEEEEEC | 24.01 | 22210691 | |
| 200 | Phosphorylation | AKGLELPSEIQREKI ECCCCCCHHHHHHHC | 61.01 | 22210691 | |
| 208 | N-linked_Glycosylation | EIQREKINHSDAKNN HHHHHHCCCHHHCCC | 39.41 | UniProtKB CARBOHYD |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of FAM3B_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of FAM3B_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of FAM3B_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| A4_HUMAN | APP | physical | 21832049 | |
| TM9S4_HUMAN | TM9SF4 | physical | 28514442 | |
| ITPA_HUMAN | ITPA | physical | 28514442 | |
| CAR19_HUMAN | C9orf89 | physical | 28514442 | |
| GNPTA_HUMAN | GNPTAB | physical | 28514442 | |
| LRP5_HUMAN | LRP5 | physical | 28514442 | |
| ANR46_HUMAN | ANKRD46 | physical | 28514442 | |
| CBWD1_HUMAN | CBWD1 | physical | 28514442 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...