UniProt ID | CAR19_HUMAN | |
---|---|---|
UniProt AC | Q96LW7 | |
Protein Name | Caspase recruitment domain-containing protein 19 | |
Gene Name | CARD19 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 228 | |
Subcellular Localization |
Isoform 1: Nucleus . Coexpression with BCL10 induced translocation from nucleus to cytosol. Isoform 2: Endoplasmic reticulum membrane Single-pass membrane protein . Mitochondrion membrane Single-pass membrane protein . |
|
Protein Description | Plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit the phosphorylation of BCL10 in a CARD-dependent manner.. | |
Protein Sequence | MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRGSLHVCVDSNLVPTAAWRS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MTDQTYCDR ------CCCCCHHHH | 20860994 | ||
18 | Phosphorylation | VQDTPFLTGHGRLSE HHCCCCCCCCCCCCH | 20363803 | ||
38 | Phosphorylation | IILQLNRYYPQILTN HHHHHHHHCHHHHCH | 27067055 | ||
39 | Phosphorylation | ILQLNRYYPQILTNK HHHHHHHCHHHHCHH | 27067055 | ||
44 | Phosphorylation | RYYPQILTNKEAEKF HHCHHHHCHHHHHHH | 27067055 | ||
46 | Malonylation | YPQILTNKEAEKFRN CHHHHCHHHHHHHCC | 26320211 | ||
46 | Ubiquitination | YPQILTNKEAEKFRN CHHHHCHHHHHHHCC | - | ||
104 (in isoform 2) | Phosphorylation | - | 24275569 | ||
104 | Phosphorylation | SRHALRKFHITNHAC CHHHHHHHCCCCCCE | - | ||
107 (in isoform 2) | Phosphorylation | - | 27251275 | ||
111 (in isoform 2) | Phosphorylation | - | 28450419 | ||
111 | Phosphorylation | FHITNHACLVLARGG HCCCCCCEEEECCCC | 27251275 | ||
113 | Phosphorylation | ITNHACLVLARGGHP CCCCCEEEECCCCCC | 24719451 | ||
113 (in isoform 2) | Phosphorylation | - | 17525332 | ||
115 (in isoform 2) | Phosphorylation | - | 28450419 | ||
119 (in isoform 2) | Phosphorylation | - | 27251275 | ||
160 (in isoform 2) | Phosphorylation | - | 27050516 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAR19_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAR19_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAR19_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
BCL10_HUMAN | BCL10 | physical | 15637807 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...