| UniProt ID | CAR19_HUMAN | |
|---|---|---|
| UniProt AC | Q96LW7 | |
| Protein Name | Caspase recruitment domain-containing protein 19 | |
| Gene Name | CARD19 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 228 | |
| Subcellular Localization |
Isoform 1: Nucleus . Coexpression with BCL10 induced translocation from nucleus to cytosol. Isoform 2: Endoplasmic reticulum membrane Single-pass membrane protein . Mitochondrion membrane Single-pass membrane protein . |
|
| Protein Description | Plays a role in inhibiting the effects of BCL10-induced activation of NF-kappa-B. May inhibit the phosphorylation of BCL10 in a CARD-dependent manner.. | |
| Protein Sequence | MTDQTYCDRLVQDTPFLTGHGRLSEQQVDRIILQLNRYYPQILTNKEAEKFRNPKASLRVRLCDLLSHLQRSGERDCQEFYRALYIHAQPLHSRLPSRHALRKFHITNHACLVLARGGHPSLPLMAWMSSMTTQVCCSPGLASPLASAPPQRPPSGPEGRVWQAQAVQMLVSVSHFLPLPPSLSHGSFHTAWGILYVHSCPSFSNLIPRGSLHVCVDSNLVPTAAWRS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Phosphorylation | ------MTDQTYCDR ------CCCCCHHHH | 20860994 | ||
| 18 | Phosphorylation | VQDTPFLTGHGRLSE HHCCCCCCCCCCCCH | 20363803 | ||
| 38 | Phosphorylation | IILQLNRYYPQILTN HHHHHHHHCHHHHCH | 27067055 | ||
| 39 | Phosphorylation | ILQLNRYYPQILTNK HHHHHHHCHHHHCHH | 27067055 | ||
| 44 | Phosphorylation | RYYPQILTNKEAEKF HHCHHHHCHHHHHHH | 27067055 | ||
| 46 | Malonylation | YPQILTNKEAEKFRN CHHHHCHHHHHHHCC | 26320211 | ||
| 46 | Ubiquitination | YPQILTNKEAEKFRN CHHHHCHHHHHHHCC | - | ||
| 104 (in isoform 2) | Phosphorylation | - | 24275569 | ||
| 104 | Phosphorylation | SRHALRKFHITNHAC CHHHHHHHCCCCCCE | - | ||
| 107 (in isoform 2) | Phosphorylation | - | 27251275 | ||
| 111 (in isoform 2) | Phosphorylation | - | 28450419 | ||
| 111 | Phosphorylation | FHITNHACLVLARGG HCCCCCCEEEECCCC | 27251275 | ||
| 113 | Phosphorylation | ITNHACLVLARGGHP CCCCCEEEECCCCCC | 24719451 | ||
| 113 (in isoform 2) | Phosphorylation | - | 17525332 | ||
| 115 (in isoform 2) | Phosphorylation | - | 28450419 | ||
| 119 (in isoform 2) | Phosphorylation | - | 27251275 | ||
| 160 (in isoform 2) | Phosphorylation | - | 27050516 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CAR19_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CAR19_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CAR19_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| BCL10_HUMAN | BCL10 | physical | 15637807 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
