ERH_SCHPO - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ERH_SCHPO
• UniProt AC: G2TRN4
• Protein Name: Enhancer of rudimentary homolog
• Gene Name: new10
• Organism: Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
• Sequence Length: 104
• Protein Description: May have a role in the cell cycle..
• Protein Sequence: MSPPPAESHIILLIQQGSDPKTRIWSDHCSLRSAIEYIVGVYQTNQAVSEKESIDVSRFFNFFDEIYDCVPLVYDRHFRAYIPHEKQWLLHHAQEYLTAARQIP

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MSPPPAESH ------CCCCCCHHC	46.22	29996109
8	Phosphorylation	MSPPPAESHIILLIQ CCCCCCHHCEEEEEE	23.30	29996109

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ERH_SCHPO !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ERH_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ERH_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MEI4_SCHPO	mei4	genetic	26942678
MMI1_SCHPO	mmi1	physical	26942678
YLP3_SCHPO	red1	physical	26942678
YE02_SCHPO	mtl1	physical	26942678
YFPE_SCHPO	iss10	physical	26942678
NOT1_SCHPO	not1	physical	26942678
NOT2_SCHPO	not2	physical	26942678
NOT3_SCHPO	not3	physical	26942678
CAF1_SCHPO	caf1	physical	26942678
YAC4_SCHPO	mot2	physical	26942678
CCR4_SCHPO	ccr4	physical	26942678
RCD1_SCHPO	rcd1	physical	26942678
VGL1_SCHPO	vgl1	physical	26942678
PABP_SCHPO	pabp	physical	26942678

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.