| UniProt ID | EMRE_HUMAN | |
|---|---|---|
| UniProt AC | Q9H4I9 | |
| Protein Name | Essential MCU regulator, mitochondrial {ECO:0000303|PubMed:24231807} | |
| Gene Name | SMDT1 {ECO:0000312|HGNC:HGNC:25055} | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 107 | |
| Subcellular Localization |
Mitochondrion inner membrane Single-pass membrane protein . MAIP1 is required to assist sorting of EMRE/SMDT1 into mitochondrion by protecting EMRE/SMDT1 against protein degradation by YME1L1, thereby ensuring SMDT1/EMRE maturation by the mitochond |
|
| Protein Description | Essential regulatory subunit of the mitochondrial calcium uniporter complex (uniplex), a complex that mediates calcium uptake into mitochondria. [PubMed: 24231807] | |
| Protein Sequence | MASGAARWLVLAPVRSGALRSGPSLRKDGDVSAAWSGSGRSLVPSRSVIVTRSGAILPKPVKMSFGLLRVFSIVIPFLYVGTLISKNFAALLEEHDIFVPEDDDDDD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 64 | O-linked_Glycosylation | LPKPVKMSFGLLRVF CCCCEEECHHHHHHH | 30379171 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of EMRE_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of EMRE_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of EMRE_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MYLK2_HUMAN | MYLK2 | physical | 26186194 | |
| MYLK2_HUMAN | MYLK2 | physical | 28514442 | |
| EI2BA_HUMAN | EIF2B1 | physical | 27173435 | |
| EI2BB_HUMAN | EIF2B2 | physical | 27173435 | |
| EI2BD_HUMAN | EIF2B4 | physical | 27173435 | |
| BZW2_HUMAN | BZW2 | physical | 27173435 | |
| MCU_HUMAN | MCU | physical | 27173435 | |
| EI2BE_HUMAN | EIF2B5 | physical | 27173435 | |
| EI2BG_HUMAN | EIF2B3 | physical | 27173435 | |
| MTOR_HUMAN | MTOR | physical | 27173435 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
