UniProt ID | ELMD1_HUMAN | |
---|---|---|
UniProt AC | Q8N336 | |
Protein Name | ELMO domain-containing protein 1 | |
Gene Name | ELMOD1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 334 | |
Subcellular Localization | ||
Protein Description | Acts as a GTPase-activating protein (GAP) toward guanine nucleotide exchange factors like ARL2, ARL3, ARF1 and ARF6, but not for GTPases outside the Arf family.. | |
Protein Sequence | MKHFLRMLIQVCLYFYCKFLWRCLKFVMRKLTGRCELQRICYNTKPGASRTMKIETSLRDSKSKLLQTSVSVHPDAIEKTIEDIMELKKINPDVNPQLGISLQACLLQIVGYRNLIADVEKLRREAYDSDNPQHEEMLLKLWKFLKPNTPLESRISKQWCEIGFQGDDPKTDFRGMGLLGLYNLQYFAERDATAAQQVLSDSLHPKCRDITKEEISKFSKAEWEKKRMDKAIGYSFAIVGINITDLAYNLLVSGALKTHFYNIAPEAPTLSHFQQTFCYLMHEFHKFWIEEDPMDIMEFNRVREKFRKRIIKQLQNPDMALCPHFAASEGLINM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
45 | Ubiquitination | QRICYNTKPGASRTM EHHHCCCCCCCCCCE | 37.50 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ELMD1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ELMD1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ELMD1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
SBP1_HUMAN | SELENBP1 | physical | 26186194 | |
LRC15_HUMAN | LRRC15 | physical | 26186194 | |
PKP3_HUMAN | PKP3 | physical | 26186194 | |
LEG3_HUMAN | LGALS3 | physical | 26186194 | |
DSG4_HUMAN | DSG4 | physical | 26186194 | |
LRC15_HUMAN | LRRC15 | physical | 28514442 | |
LDHC_HUMAN | LDHC | physical | 28514442 | |
PKP3_HUMAN | PKP3 | physical | 28514442 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...