EDL3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: EDL3_ARATH
• UniProt AC: Q93ZT5
• Protein Name: EID1-like F-box protein 3
• Gene Name: EDL3
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 272
• Protein Sequence: MLLEGRFSVVQMNTNRRLKFNQPSRLPNSGKSGIENERVLVLVFESISWDIHTLCTIASLSRRFCAIARRILWRRLCVNRAPGMVAALSGEDPSGRIDGGWHALAKLMFFCGGGESTRYFNLSQPTSGHFACESRFSKTSGRFFLPKNCRRDLLYMSDPCEHQAVGGDEHLGVFRGVFREFMRSKTRECLVRRQAALEEKVRCPYCGGRVWSMTAARLVPKSAARRLGSREGGLEFFVCVNGHLHGTCWLIPLSSEEEDNGEDDDNSDGSVI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Oops, there are no PTM records of EDL3_ARATH !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of EDL3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of EDL3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of EDL3_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SKP1A_ARATH	SKP1	physical	21831845
SKP1B_ARATH	ASK2	physical	21831845
ASK4_ARATH	SK4	physical	21831845
ASK5_ARATH	SK5	physical	21831845
ASK11_ARATH	SK11	physical	21831845
ASK13_ARATH	SK13	physical	21831845
ASK14_ARATH	SK14	physical	21831845
ASK18_ARATH	SK18	physical	21831845

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.