| UniProt ID | DYLT_DROME | |
|---|---|---|
| UniProt AC | Q94524 | |
| Protein Name | Dynein light chain Tctex-type | |
| Gene Name | Dlc90F | |
| Organism | Drosophila melanogaster (Fruit fly). | |
| Sequence Length | 111 | |
| Subcellular Localization | Cytoplasm, cytoskeleton . | |
| Protein Description | Acts as one of several non-catalytic accessory components of the cytoplasmic dynein complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. Required for spermatid differentiation. Is not required for polarized transport in rhabdomere development and appears to be a non-essential component of the cytoplasmic dynein complex.. | |
| Protein Sequence | MDDSREESQFIVDDVSKTIKEAIETTIGGNAYQHDKVNNWTGQVVENCLTVLTKEQKPYKYIVTAMIMQKNGAGLHTASSCYWNNDTDGSCTVRWENKTMYCIVSVFGLAV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | Phosphorylation | ----MDDSREESQFI ----CCCCHHHHHHH | 37.01 | 19429919 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DYLT_DROME !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DYLT_DROME !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DYLT_DROME !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| METL_DROME | metl | physical | 14605208 | |
| FUR2_DROME | Fur2 | physical | 14605208 | |
| HSP6C_DROME | Hsp67Bc | physical | 14605208 | |
| UBCD2_DROME | UbcD2 | physical | 14605208 | |
| BSG2_DROME | Bsg25D | physical | 14605208 | |
| ENA_DROME | ena | physical | 14605208 | |
| NDKA_DROME | awd | physical | 14605208 | |
| HSP23_DROME | Hsp23 | physical | 14605208 | |
| OTE_DROME | Ote | physical | 14605208 | |
| JMJD6_DROME | PSR | physical | 22036573 | |
| DYL1_DROME | ctp | physical | 20472935 | |
| DYIN_DROME | sw | physical | 16949604 | |
| DYIN_DROME | sw | physical | 20472935 | |
| DYIN_DROME | sw | physical | 11914076 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
