UniProt ID | DOG2_YEAST | |
---|---|---|
UniProt AC | P38773 | |
Protein Name | 2-deoxyglucose-6-phosphate phosphatase 2 | |
Gene Name | DOG2 | |
Organism | Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). | |
Sequence Length | 246 | |
Subcellular Localization | ||
Protein Description | Active on 2-DOG-6P, not very active on fructose-1p.. | |
Protein Sequence | MPQFSVDLCLFDLDGTIVSTTTAAESAWKKLCRQHGVDPVELFKHSHGARSQEMMKKFFPKLDNTDNKGVLALEKDMADNYLDTVSLIPGAENLLLSLDVDTETQKKLPERKWAIVTSGSPYLAFSWFETILKNVGKPKVFITGFDVKNGKPDPEGYSRARDLLRQDLQLTGKQDLKYVVFEDAPVGIKAGKAMGAITVGITSSYDKSVLFDAGADYVVCDLTQVSVVKNNENGIVIQVNNPLTRD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
61 | Acetylation | MMKKFFPKLDNTDNK HHHHHCCCCCCCCCC | 64.41 | 24489116 | |
148 | Acetylation | FITGFDVKNGKPDPE EEEEEECCCCCCCCC | 62.92 | 24489116 | |
177 | Acetylation | LTGKQDLKYVVFEDA CCCCCCCEEEEEECC | 44.26 | 24489116 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DOG2_YEAST !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DOG2_YEAST !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DOG2_YEAST !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
2ABA_YEAST | CDC55 | genetic | 19269370 | |
ADK_YEAST | ADO1 | genetic | 19269370 | |
DEP1_YEAST | DEP1 | genetic | 20093466 | |
SNT1_YEAST | SNT1 | genetic | 20093466 | |
FPS1_YEAST | FPS1 | genetic | 20093466 | |
FAR10_YEAST | FAR10 | genetic | 20093466 | |
VPH1_YEAST | VPH1 | genetic | 20093466 | |
YPQ3_YEAST | RTC2 | genetic | 27708008 | |
ESC2_YEAST | ESC2 | genetic | 27708008 | |
HSP12_YEAST | HSP12 | genetic | 27708008 | |
CWP2_YEAST | CWP2 | genetic | 27708008 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...