DLX1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: DLX1_MOUSE
• UniProt AC: Q64317
• Protein Name: Homeobox protein DLX-1
• Gene Name: Dlx1
• Organism: Mus musculus (Mouse).
• Sequence Length: 255
• Subcellular Localization: Nucleus .
• Protein Description: Plays a role as a transcriptional activator or repressor. [PubMed: 21875655 Inhibits several cytokine signaling pathways, such as TGFB1, activin-A/INHBA and BMP4 by interfering with the transcriptional stimulatory activity of transcription factors, such as MSX2, FAST2, SMAD2 and SMAD3 during hematopoietic cell differentiation (By similarity Plays a role in terminal differentiation of interneurons, such as amacrine and bipolar cells in the developing retina]
• Protein Sequence: MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGHSQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSRLEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGSSAGSYVPSYTSWYPSAHQEAMQQPQLM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
9	Phosphorylation	TMTTMPESLNSPVSG CCCCCCHHHCCCCCC	27.29	-
12	Phosphorylation	TMPESLNSPVSGKAV CCCHHHCCCCCCCEE	31.78	25338131
136	Phosphorylation	RKPRTIYSSLQLQAL CCCCCHHHHHHHHHH	22.26	-
206	Phosphorylation	LANGRALSAGSPPVP HHCCCCCCCCCCCCC	29.60	25619855
209	Phosphorylation	GRALSAGSPPVPPGW CCCCCCCCCCCCCCC	26.25	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of DLX1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of DLX1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of DLX1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
DLX2_MOUSE	Dlx2	physical	20211142
FOXA1_MOUSE	Foxa1	physical	20211142
HXB13_MOUSE	Hoxb13	physical	20211142
MIXL1_MOUSE	Mixl1	physical	20211142
TBX21_MOUSE	Tbx21	physical	20211142
SP7_MOUSE	Sp7	physical	20211142

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.