FOXA1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: FOXA1_MOUSE
• UniProt AC: P35582
• Protein Name: Hepatocyte nuclear factor 3-alpha
• Gene Name: Foxa1
• Organism: Mus musculus (Mouse).
• Sequence Length: 468
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that is involved in embryonic development, establishment of tissue-specific gene expression and regulation of gene expression in differentiated tissues. Is thought to act as a 'pioneer' factor opening the compacted chromatin for other proteins through interactions with nucleosomal core histones and thereby replacing linker histones at target enhancer and/or promoter sites. Binds DNA with the consensus sequence 5'-[AC]A[AT]T[AG]TT[GT][AG][CT]T[CT]-3' (By similarity). Proposed to play a role in translating the epigenetic signatures into cell type-specific enhancer-driven transcriptional programs. Involved in the development of multiple endoderm-derived organ systems such as the liver, pancreas, lungs and prostate; FOXA1 and FOXA2 seem to have at least in part redundant roles. Plays a role in prostate morphogenesis and epithelial cell differentiation. FOXA1 and FOXA2 are essential for hepatic specification. FOXA1 and FOXA2 are required for morphogenesis and cell differentiation during formation of the lung. FOXA1 and FOXA2 are involved in bile duct formation; they positively regulate the binding of glucocorticoid receptor/NR3C1 to the IL6 promoter. FOXA1 and FOXA2 regulate multiple phases of midbrain dopaminergic neuron development; they regulate expression of NEUROG2 at the beginning of mDA neurogenesis and of NR4A2 and EN1 in immature mDA neurons. Modulates the transcriptional activity of nuclear hormone receptors. Is involved in ESR1-mediated transcription. Inhibits NKX2-1-mediated transcription from the SFTPC promoter in lung epithel independently from DNA-binding. Involved in regulation of apoptosis. Involved in cell cycle regulation. Originally described as a transcription activator for a number of liver genes such as AFP, albumin, tyrosine aminotransferase, PEPCK, etc. Interacts with the cis-acting regulatory regions of these genes. Involved in glucose homeostasis; activates the GCG promoter..
• Protein Sequence: MLGTVKMEGHESNDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANTGLGAGLSPGAVAGMPGASAGAMNSMTAAGVTAMGTALSPGGMGSMGAQPATSMNGLGPYAAAMNPCMSPMAYAPSNLGRSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGSGGGGSKGGPESRKDPSGPGNPSAESPLHRGVHGKASQLEGAPAPGPAASPQTLDHSGATATGGASELKSPASSSAPPISSGPGALASVPPSHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGATLPASLPLGSASVATRSPIEPSALEPAYYQGVYSRPVLNTS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
223	Phosphorylation	NSIRHSLSFNDCFVK HHHHHHCHHCCEEEE	25.64	22817900
234	Phosphorylation	CFVKVARSPDKPGKG EEEEEECCCCCCCCC	27.93	30352176
300	Phosphorylation	PSGPGNPSAESPLHR CCCCCCCCCCCCCCC	48.98	29472430
303	Phosphorylation	PGNPSAESPLHRGVH CCCCCCCCCCCCCCC	32.26	25521595
314	Phosphorylation	RGVHGKASQLEGAPA CCCCCCHHHCCCCCC	38.49	20469934
327	Phosphorylation	PAPGPAASPQTLDHS CCCCCCCCCCCCCCC	21.46	26239621
330	Phosphorylation	GPAASPQTLDHSGAT CCCCCCCCCCCCCCC	37.22	25521595
334	Phosphorylation	SPQTLDHSGATATGG CCCCCCCCCCCCCCC	29.77	29472430
337	Phosphorylation	TLDHSGATATGGASE CCCCCCCCCCCCHHH	28.42	25521595
339	Phosphorylation	DHSGATATGGASELK CCCCCCCCCCHHHCC	31.62	22324799
343	Phosphorylation	ATATGGASELKSPAS CCCCCCHHHCCCCCC	46.89	23984901
444	Phosphorylation	SASVATRSPIEPSAL CCCEECCCCCCHHHC	26.35	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of FOXA1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of FOXA1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of FOXA1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of FOXA1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale phosphorylation analysis of mouse liver.";
Villen J., Beausoleil S.A., Gerber S.A., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 104:1488-1493(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-339, AND MASSSPECTROMETRY.
PubMed: 17242355