| UniProt ID | DLX2_MOUSE | |
|---|---|---|
| UniProt AC | P40764 | |
| Protein Name | Homeobox protein DLX-2 | |
| Gene Name | Dlx2 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 332 | |
| Subcellular Localization | Nucleus . | |
| Protein Description | Acts as a transcriptional activator. [PubMed: 21875655 Plays a role in terminal differentiation of interneurons, such as amacrine and bipolar cells in the developing retina] | |
| Protein Sequence | MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGPGGNSNSSSSNSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAPQRMAGGGPGSGGGGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHAGGGAPVSAGTIF | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | Phosphorylation | HQHQQPPSGAGAGPG CCCCCCCCCCCCCCC | 48.21 | - | |
| 45 | Phosphorylation | GGNSNSSSSNSSLHK CCCCCCCCCCCCCCC | 33.10 | - | |
| 46 | Phosphorylation | GNSNSSSSNSSLHKP CCCCCCCCCCCCCCC | 42.55 | - | |
| 49 | Phosphorylation | NSSSSNSSLHKPQES CCCCCCCCCCCCCCC | 38.45 | - | |
| 235 | Phosphorylation | SASPPCASPPVSAPA CCCCCCCCCCCCCCC | 36.13 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLX2_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLX2_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLX2_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MSX1_MOUSE | Msx1 | physical | 20211142 | |
| SP7_MOUSE | Sp7 | physical | 20211142 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...