UniProt ID | DLX2_MOUSE | |
---|---|---|
UniProt AC | P40764 | |
Protein Name | Homeobox protein DLX-2 | |
Gene Name | Dlx2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 332 | |
Subcellular Localization | Nucleus . | |
Protein Description | Acts as a transcriptional activator. [PubMed: 21875655 Plays a role in terminal differentiation of interneurons, such as amacrine and bipolar cells in the developing retina] | |
Protein Sequence | MTGVFDSLVADMHSTQITASSTYHQHQQPPSGAGAGPGGNSNSSSSNSSLHKPQESPTLPVSTATDSSYYTNQQHPAGGGGGGASPYAHMGSYQYHASGLNNVSYSAKSSYDLGYTAAYTSYAPYGTSSSPVNNEPDKEDLEPEIRIVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKKMWKSGEIPTEQHPGASASPPCASPPVSAPASWDFGAPQRMAGGGPGSGGGGAGSSGSSPSSAASAFLGNYPWYHQASGSASHLQATAPLLHPSQTPQAHHHHHHHHHAGGGAPVSAGTIF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | Phosphorylation | HQHQQPPSGAGAGPG CCCCCCCCCCCCCCC | 48.21 | - | |
45 | Phosphorylation | GGNSNSSSSNSSLHK CCCCCCCCCCCCCCC | 33.10 | - | |
46 | Phosphorylation | GNSNSSSSNSSLHKP CCCCCCCCCCCCCCC | 42.55 | - | |
49 | Phosphorylation | NSSSSNSSLHKPQES CCCCCCCCCCCCCCC | 38.45 | - | |
235 | Phosphorylation | SASPPCASPPVSAPA CCCCCCCCCCCCCCC | 36.13 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of DLX2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of DLX2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of DLX2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MSX1_MOUSE | Msx1 | physical | 20211142 | |
SP7_MOUSE | Sp7 | physical | 20211142 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...