dbPTM

DB127_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	DB127_HUMAN
UniProt AC	Q9H1M4
Protein Name	Beta-defensin 127
Gene Name	DEFB127
Organism	Homo sapiens (Human).
Sequence Length	99
Subcellular Localization	Secreted .
Protein Description	Has antibacterial activity..
Protein Sequence	MGLFMIIAILLFQKPTVTEQLKKCWNNYVQGHCRKICRVNEVPEALCENGRYCCLNIKELEACKKITKPPRPKPATLALTLQDYVTIIENFPSLKTQST

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of DB127_HUMAN !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of DB127_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of DB127_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of DB127_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
HTRA1_HUMAN	HTRA1	physical	28514442
ARP10_HUMAN	ACTR10	physical	28514442
DCTN6_HUMAN	DCTN6	physical	28514442
DCTN5_HUMAN	DCTN5	physical	28514442
SH3BG_HUMAN	SH3BGR	physical	28514442
DCTN3_HUMAN	DCTN3	physical	28514442
DCTN4_HUMAN	DCTN4	physical	28514442
ACTBL_HUMAN	ACTBL2	physical	28514442
ACTY_HUMAN	ACTR1B	physical	28514442
ACTZ_HUMAN	ACTR1A	physical	28514442
DCTN2_HUMAN	DCTN2	physical	28514442

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of DB127_HUMAN

Related Literatures of Post-Translational Modification