UniProt ID | CYHR1_HUMAN | |
---|---|---|
UniProt AC | Q6ZMK1 | |
Protein Name | Cysteine and histidine-rich protein 1 | |
Gene Name | CYHR1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 362 | |
Subcellular Localization | Cytoplasm. Cytoplasm, perinuclear region. Shows a prominent perinuclear and cytoplasmic localization.. | |
Protein Description | ||
Protein Sequence | MAPKPGAEWSTALSHLVLGVVSLHAAVSTAEASRGAAAGFLLQVLAATTTLAPGLSTHEDCLAGAWVATVIGLPLLAFDFHWCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNINLRLFLFQIQK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
22 | Phosphorylation | HLVLGVVSLHAAVST HHHHHHHHHHHHHHH | 16.42 | - | |
28 | Phosphorylation | VSLHAAVSTAEASRG HHHHHHHHHHHHHHH | 19.71 | - | |
29 | Phosphorylation | SLHAAVSTAEASRGA HHHHHHHHHHHHHHH | 23.17 | - | |
33 | Phosphorylation | AVSTAEASRGAAAGF HHHHHHHHHHHHHHH | 23.81 | - | |
104 | Ubiquitination | LLADARLKEEQATCP HHHHHHHHHHHCCCC | 54.36 | - | |
124 | Dimethylation | ISKSLCCRNLAVEKA ECHHHHCCHHHHHHH | 39.95 | - | |
204 (in isoform 2) | Ubiquitination | - | 56.91 | 21890473 | |
261 (in isoform 2) | Ubiquitination | - | 19.23 | 21890473 | |
280 | Ubiquitination | RNPNLSCKRTLSFQL CCCCCCCCEEEEEHH | 45.07 | - | |
282 | Phosphorylation | PNLSCKRTLSFQLLL CCCCCCEEEEEHHHH | 16.55 | - | |
284 | Phosphorylation | LSCKRTLSFQLLLKS CCCCEEEEEHHHHCC | 15.44 | - | |
290 | Ubiquitination | LSFQLLLKSKVTAPL EEEHHHHCCCCCCCE | 48.47 | - | |
292 | Ubiquitination | FQLLLKSKVTAPLEC EHHHHCCCCCCCEEE | 41.85 | 21890473 | |
292 (in isoform 1) | Ubiquitination | - | 41.85 | 21890473 | |
349 | Ubiquitination | CNKLLAAKNINLRLF HHHHHHHCCCCEEEE | 53.40 | 21890473 | |
349 (in isoform 1) | Ubiquitination | - | 53.40 | 21890473 | |
362 | Ubiquitination | LFLFQIQK------- EEEEEECC------- | 65.03 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYHR1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYHR1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYHR1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MK09_HUMAN | MAPK9 | physical | 21988832 | |
ACPH_HUMAN | APEH | physical | 22863883 | |
EPN4_HUMAN | CLINT1 | physical | 22863883 | |
JMJD6_HUMAN | JMJD6 | physical | 22863883 | |
NMI_HUMAN | NMI | physical | 22863883 | |
SC24A_HUMAN | SEC24A | physical | 22863883 | |
GLYM_HUMAN | SHMT2 | physical | 22863883 | |
TOLIP_HUMAN | TOLLIP | physical | 22863883 | |
VP26A_HUMAN | VPS26A | physical | 22863883 | |
VPS35_HUMAN | VPS35 | physical | 22863883 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...