| UniProt ID | CYHR1_HUMAN | |
|---|---|---|
| UniProt AC | Q6ZMK1 | |
| Protein Name | Cysteine and histidine-rich protein 1 | |
| Gene Name | CYHR1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 362 | |
| Subcellular Localization | Cytoplasm. Cytoplasm, perinuclear region. Shows a prominent perinuclear and cytoplasmic localization.. | |
| Protein Description | ||
| Protein Sequence | MAPKPGAEWSTALSHLVLGVVSLHAAVSTAEASRGAAAGFLLQVLAATTTLAPGLSTHEDCLAGAWVATVIGLPLLAFDFHWCTNGHLMCAGCFIHLLADARLKEEQATCPNCRCEISKSLCCRNLAVEKAVSELPSECGFCLRQFPRSLLERHQKEECQDRVTQCKYKRIGCPWHGPFHELTVHEAACAHPTKTGSELMEILDGMDQSHRKEMQLYNSIFSLLSFEKIGYTEVQFRPYRTDDFITRLYYETPRFTVLNQTWVLKARVNDSERNPNLSCKRTLSFQLLLKSKVTAPLECSFLLLKGPYDDVRISPVIYHFVFTNESNETDYVPLPIIDSVECNKLLAAKNINLRLFLFQIQK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 22 | Phosphorylation | HLVLGVVSLHAAVST HHHHHHHHHHHHHHH | 16.42 | - | |
| 28 | Phosphorylation | VSLHAAVSTAEASRG HHHHHHHHHHHHHHH | 19.71 | - | |
| 29 | Phosphorylation | SLHAAVSTAEASRGA HHHHHHHHHHHHHHH | 23.17 | - | |
| 33 | Phosphorylation | AVSTAEASRGAAAGF HHHHHHHHHHHHHHH | 23.81 | - | |
| 104 | Ubiquitination | LLADARLKEEQATCP HHHHHHHHHHHCCCC | 54.36 | - | |
| 124 | Dimethylation | ISKSLCCRNLAVEKA ECHHHHCCHHHHHHH | 39.95 | - | |
| 204 (in isoform 2) | Ubiquitination | - | 56.91 | 21890473 | |
| 261 (in isoform 2) | Ubiquitination | - | 19.23 | 21890473 | |
| 280 | Ubiquitination | RNPNLSCKRTLSFQL CCCCCCCCEEEEEHH | 45.07 | - | |
| 282 | Phosphorylation | PNLSCKRTLSFQLLL CCCCCCEEEEEHHHH | 16.55 | - | |
| 284 | Phosphorylation | LSCKRTLSFQLLLKS CCCCEEEEEHHHHCC | 15.44 | - | |
| 290 | Ubiquitination | LSFQLLLKSKVTAPL EEEHHHHCCCCCCCE | 48.47 | - | |
| 292 | Ubiquitination | FQLLLKSKVTAPLEC EHHHHCCCCCCCEEE | 41.85 | 21890473 | |
| 292 (in isoform 1) | Ubiquitination | - | 41.85 | 21890473 | |
| 349 | Ubiquitination | CNKLLAAKNINLRLF HHHHHHHCCCCEEEE | 53.40 | 21890473 | |
| 349 (in isoform 1) | Ubiquitination | - | 53.40 | 21890473 | |
| 362 | Ubiquitination | LFLFQIQK------- EEEEEECC------- | 65.03 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CYHR1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CYHR1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CYHR1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MK09_HUMAN | MAPK9 | physical | 21988832 | |
| ACPH_HUMAN | APEH | physical | 22863883 | |
| EPN4_HUMAN | CLINT1 | physical | 22863883 | |
| JMJD6_HUMAN | JMJD6 | physical | 22863883 | |
| NMI_HUMAN | NMI | physical | 22863883 | |
| SC24A_HUMAN | SEC24A | physical | 22863883 | |
| GLYM_HUMAN | SHMT2 | physical | 22863883 | |
| TOLIP_HUMAN | TOLLIP | physical | 22863883 | |
| VP26A_HUMAN | VPS26A | physical | 22863883 | |
| VPS35_HUMAN | VPS35 | physical | 22863883 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
