UniProt ID | CNBL3_ARATH | |
---|---|---|
UniProt AC | Q8LEM7 | |
Protein Name | Calcineurin B-like protein 3 | |
Gene Name | CBL3 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 226 | |
Subcellular Localization |
Vacuole membrane Lipid-anchor . Tonoplast localization abolished by 2-bromopalmitate (2-BP) treatment. |
|
Protein Description | Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binds calcium ions. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement. Negatively regulates the enzyme activity of MTN1 in the presence of calcium.. | |
Protein Sequence | MSQCIDGFKHVCSSFFRCFDIDIYKQSGGLGDPELLARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIEDKIDFSFQLYDLKQQGFIERQEVKQMVVATLAESGMNLSDEIIESIIDKTFEEADTKHDGRIDKEEWRTLVLRHPSLLKNMTLQYLKDITTTFPSFVFHSQVEDT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
51 | Phosphorylation | VSEIEALYELFKKIS HHHHHHHHHHHHHHH | 20.03 | 19880383 | |
212 | Phosphorylation | QYLKDITTTFPSFVF HHHHHHHHHCCHHHC | 27.12 | 30407730 | |
213 | Phosphorylation | YLKDITTTFPSFVFH HHHHHHHHCCHHHCC | 25.54 | 30407730 | |
216 | Phosphorylation | DITTTFPSFVFHSQV HHHHHCCHHHCCCCC | 29.83 | 22547024 | |
221 | Phosphorylation | FPSFVFHSQVEDT-- CCHHHCCCCCCCC-- | 25.18 | 30407730 | |
226 | Phosphorylation | FHSQVEDT------- CCCCCCCC------- | 27.31 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CNBL3_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNBL3_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNBL3_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
MTN1_ARATH | MTN1 | physical | 18945934 | |
PKS4_ARATH | PKS4 | physical | 11402167 | |
CIPK9_ARATH | CIPK9 | physical | 11402167 | |
CIPK7_ARATH | CIPK7 | physical | 11402167 | |
CIPKO_ARATH | SOS2 | physical | 11402167 | |
CIPKE_ARATH | SR1 | physical | 19832944 | |
CIPK9_ARATH | CIPK9 | physical | 23109687 | |
CIPK3_ARATH | CIPK3 | physical | 25646412 | |
CIPK9_ARATH | CIPK9 | physical | 25646412 | |
CIPKN_ARATH | CIPK23 | physical | 25646412 | |
CIPKQ_ARATH | AT5G21326 | physical | 25646412 | |
MTN1_ARATH | MTN1 | physical | 26259190 | |
MTN2_ARATH | MTN2 | physical | 26259190 | |
CIPKL_ARATH | CIPK21 | physical | 26198257 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...