CNBL1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CNBL1_ARATH
• UniProt AC: O81445
• Protein Name: Calcineurin B-like protein 1
• Gene Name: CBL1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 213
• Subcellular Localization: Cell membrane ; Lipid-anchor . The cell membrane localization is S-acylation dependent and is abolished by 2-bromopalmitate (2-BP) treatment.
• Protein Description: Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses. May function as a positive regulator of salt and drought responses and as a negative regulator of cold response. Contributes to the regulation of early stress-related CBF/DREB transcription factors. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement. Involved in response to glucose and gibberellin during germination and seedling development and in response to cold stress. Involved in the calcium-dependent regulation by CIPK26 of reactive oxygen species production by the NADPH oxidase RBOHF..
• Protein Sequence: MGCFHSKAAKEFRGHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLALFKSRKRENIFANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVKQMLIALLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGCFHSKAA ------CCCCCHHHH	23.85	18502848
3	Stearoylation	-----MGCFHSKAAK -----CCCCCHHHHH	2.40	18502848
3	S-palmitoylation	-----MGCFHSKAAK -----CCCCCHHHHH	2.40	18502848
196	Phosphorylation	LPYLRDITTTFPSFV HHHHCCCCCCCCCHH	24.87	30407730
197	Phosphorylation	PYLRDITTTFPSFVF HHHCCCCCCCCCHHC	27.12	30407730
198	Phosphorylation	YLRDITTTFPSFVFH HHCCCCCCCCCHHCC	25.54	30407730
201	Phosphorylation	DITTTFPSFVFHSEV CCCCCCCCHHCCCCH	29.83	18502848
206	Phosphorylation	FPSFVFHSEVDEIAT CCCHHCCCCHHCCCC	28.05	30407730
213	Phosphorylation	SEVDEIAT------- CCHHCCCC-------	44.82	30407730

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
201	S	Phosphorylation	Kinase	CIPK23	Q93VD3	Uniprot

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CNBL1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CNBL1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
CIPKF_ARATH	CIPK15	physical	11402167
PKS4_ARATH	PKS4	physical	11402167
CIPK9_ARATH	CIPK9	physical	11402167
CIPKO_ARATH	SOS2	physical	11402167
CIPKF_ARATH	CIPK15	physical	12194854
P4KB1_ARATH	PI-4KBETA1	physical	16567499
CIPKO_ARATH	SOS2	physical	19832944
CIPK7_ARATH	CIPK7	physical	21600398
CIPKO_ARATH	SOS2	physical	21798944
GONS1_ARATH	GONST1	physical	22737156
GDU2_ARATH	GDU2	physical	22737156
CNG13_ARATH	CNGC13	physical	22737156
PUP21_ARATH	AT4G18220	physical	22737156
CIPKO_ARATH	SOS2	physical	22253446
CIPKN_ARATH	CIPK23	physical	17922773
KINB1_ARATH	AKINBETA1	physical	23437128
CANB1_RAT	Ppp3r1	physical	10200328

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.