UniProt ID | CNBL1_ARATH | |
---|---|---|
UniProt AC | O81445 | |
Protein Name | Calcineurin B-like protein 1 | |
Gene Name | CBL1 | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 213 | |
Subcellular Localization |
Cell membrane Lipid-anchor . The cell membrane localization is S-acylation dependent and is abolished by 2-bromopalmitate (2-BP) treatment. |
|
Protein Description | Acts as a calcium sensor involved in the signaling pathway during growth and development and in response to abiotic stresses. May function as a positive regulator of salt and drought responses and as a negative regulator of cold response. Contributes to the regulation of early stress-related CBF/DREB transcription factors. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner. Mediates the activation of AKT1 by CIPK proteins (CIPK6, CIPK16, and CIPK23) in response to low potassium conditions and in the context of stomatal movement. Involved in response to glucose and gibberellin during germination and seedling development and in response to cold stress. Involved in the calcium-dependent regulation by CIPK26 of reactive oxygen species production by the NADPH oxidase RBOHF.. | |
Protein Sequence | MGCFHSKAAKEFRGHEDPVKLASETAFSVSEVEALFELFKSISSSVVDDGLINKEEFQLALFKSRKRENIFANRIFDMFDVKRKGVIDFGDFVRSLNVFHPNASLEDKIDFTFRLYDMDCTGYIERQEVKQMLIALLCESEMKLADETIEIILDKTFEDADVNQDGKIDKLEWSDFVNKNPSLLKIMTLPYLRDITTTFPSFVFHSEVDEIAT | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGCFHSKAA ------CCCCCHHHH | 23.85 | 18502848 | |
3 | Stearoylation | -----MGCFHSKAAK -----CCCCCHHHHH | 2.40 | 18502848 | |
3 | S-palmitoylation | -----MGCFHSKAAK -----CCCCCHHHHH | 2.40 | 18502848 | |
196 | Phosphorylation | LPYLRDITTTFPSFV HHHHCCCCCCCCCHH | 24.87 | 30407730 | |
197 | Phosphorylation | PYLRDITTTFPSFVF HHHCCCCCCCCCHHC | 27.12 | 30407730 | |
198 | Phosphorylation | YLRDITTTFPSFVFH HHCCCCCCCCCHHCC | 25.54 | 30407730 | |
201 | Phosphorylation | DITTTFPSFVFHSEV CCCCCCCCHHCCCCH | 29.83 | 18502848 | |
206 | Phosphorylation | FPSFVFHSEVDEIAT CCCHHCCCCHHCCCC | 28.05 | 30407730 | |
213 | Phosphorylation | SEVDEIAT------- CCHHCCCC------- | 44.82 | 30407730 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
201 | S | Phosphorylation | Kinase | CIPK23 | Q93VD3 | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CNBL1_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CNBL1_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CIPKF_ARATH | CIPK15 | physical | 11402167 | |
PKS4_ARATH | PKS4 | physical | 11402167 | |
CIPK9_ARATH | CIPK9 | physical | 11402167 | |
CIPKO_ARATH | SOS2 | physical | 11402167 | |
CIPKF_ARATH | CIPK15 | physical | 12194854 | |
P4KB1_ARATH | PI-4KBETA1 | physical | 16567499 | |
CIPKO_ARATH | SOS2 | physical | 19832944 | |
CIPK7_ARATH | CIPK7 | physical | 21600398 | |
CIPKO_ARATH | SOS2 | physical | 21798944 | |
GONS1_ARATH | GONST1 | physical | 22737156 | |
GDU2_ARATH | GDU2 | physical | 22737156 | |
CNG13_ARATH | CNGC13 | physical | 22737156 | |
PUP21_ARATH | AT4G18220 | physical | 22737156 | |
CIPKO_ARATH | SOS2 | physical | 22253446 | |
CIPKN_ARATH | CIPK23 | physical | 17922773 | |
KINB1_ARATH | AKINBETA1 | physical | 23437128 | |
CANB1_RAT | Ppp3r1 | physical | 10200328 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...