KINB1_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: KINB1_ARATH
• UniProt AC: Q84VQ1
• Protein Name: SNF1-related protein kinase regulatory subunit beta-1
• Gene Name: KINB1
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 283
• Protein Description: Regulatory subunit of the probable trimeric SNF1-related protein kinase (SnRK) complex, which may play a role in a signal transduction cascade regulating gene expression and carbohydrate metabolism in higher plants. The SnRK complex may also be involved in the regulation of fatty acid synthesis by phosphorylation of acetyl-CoA carboxylase and in assimilation of nitrogen by phosphorylating nitrate reductase..
• Protein Sequence: MGNANGKDEDAAAGSGGADVTSSSARSNGGDPSARSRHRRPSSDSMSSSPPGSPARSPSPFLFAPQVPVAPLQRANAPPPNNIQWNQSQRVFDNPPEQGIPTIITWNQGGNDVAVEGSWDNWRSRKKLQKSGKDHSILFVLPSGIYHYKVIVDGESKYIPDLPFVADEVGNVCNILDVHNFVPENPESIVEFEAPPSPDHSYGQTLPAAEDYAKEPLAVPPQLHLTLLGTTEETAIATKPQHVVLNHVFIEQGWTPQSIVALGLTHRFESKYITVVLYKPLTR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Myristoylation	------MGNANGKDE ------CCCCCCCHH	41.79	17827350
42	Phosphorylation	RSRHRRPSSDSMSSS HHCCCCCCCCCCCCC	44.99	23776212
43	Phosphorylation	SRHRRPSSDSMSSSP HCCCCCCCCCCCCCC	36.07	23776212
45	Phosphorylation	HRRPSSDSMSSSPPG CCCCCCCCCCCCCCC	23.63	23776212
47	Phosphorylation	RPSSDSMSSSPPGSP CCCCCCCCCCCCCCC	31.45	23776212
48	Phosphorylation	PSSDSMSSSPPGSPA CCCCCCCCCCCCCCC	37.92	23776212
49	Phosphorylation	SSDSMSSSPPGSPAR CCCCCCCCCCCCCCC	28.01	23776212
53	Phosphorylation	MSSSPPGSPARSPSP CCCCCCCCCCCCCCC	22.59	23776212
57	Phosphorylation	PPGSPARSPSPFLFA CCCCCCCCCCCCCCC	31.66	23111157
59	Phosphorylation	GSPARSPSPFLFAPQ CCCCCCCCCCCCCCC	29.54	23111157
88	Phosphorylation	NNIQWNQSQRVFDNP CCCCCCHHHCCCCCC	19.42	30407730
197	Phosphorylation	VEFEAPPSPDHSYGQ EEEECCCCCCCCCCC	41.73	19376835

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of KINB1_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of KINB1_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of KINB1_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
SNF4_ARATH	SNF4	physical	17028154
SNF1_YEAST	SNF1	physical	10417704

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Large-scale Arabidopsis phosphoproteome profiling reveals novelchloroplast kinase substrates and phosphorylation networks.";
Reiland S., Messerli G., Baerenfaller K., Gerrits B., Endler A.,Grossmann J., Gruissem W., Baginsky S.;
Plant Physiol. 150:889-903(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-197, AND MASSSPECTROMETRY.
PubMed: 19376835