| UniProt ID | CANB1_RAT | |
|---|---|---|
| UniProt AC | P63100 | |
| Protein Name | Calcineurin subunit B type 1 | |
| Gene Name | Ppp3r1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 170 | |
| Subcellular Localization |
Cytoplasm, cytosol . Cell membrane . Cell membrane, sarcolemma . Cell membrane Lipid-anchor . Translocates from the cytosol to the sarcolemma in a CIB1-dependent manner during cardiomyocyte hypertrophy. |
|
| Protein Description | Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.. | |
| Protein Sequence | MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | N-myristoyl glycine | ------MGNEASYPL ------CCCCCCCCH | 40.46 | - | |
| 2 | Myristoylation | ------MGNEASYPL ------CCCCCCCCH | 40.46 | - | |
| 85 | Ubiquitination | GVSQFSVKGDKEQKL CCCEEEECCCHHHHE | 61.26 | - | |
| 106 | Phosphorylation | YDMDKDGYISNGELF EECCCCCCCCHHHHH | 16.00 | - | |
| 125 | Acetylation | MMVGNNLKDTQLQQI HHHCCCCCHHHHHHH | 61.93 | 22902405 | |
| 125 | Ubiquitination | MMVGNNLKDTQLQQI HHHCCCCCHHHHHHH | 61.93 | - | |
| 135 | Acetylation | QLQQIVDKTIINADK HHHHHHCCEEECCCC | 30.63 | 22902405 | |
| 142 | Acetylation | KTIINADKDGDGRIS CEEECCCCCCCCCCC | 62.29 | 22902405 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CANB1_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CANB1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CANB1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of CANB1_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
