UniProt ID | CLD2_HUMAN | |
---|---|---|
UniProt AC | P57739 | |
Protein Name | Claudin-2 | |
Gene Name | CLDN2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 230 | |
Subcellular Localization |
Cell junction, tight junction. Cell membrane Multi-pass membrane protein. |
|
Protein Description | Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.. | |
Protein Sequence | MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
192 | Phosphorylation | CSSQRNRSNYYDAYQ CCCCCCCCCCCHHHH | 32.50 | 21253578 | |
194 | Phosphorylation | SQRNRSNYYDAYQAQ CCCCCCCCCHHHHCC | 12.17 | 21609022 | |
195 | Phosphorylation | QRNRSNYYDAYQAQP CCCCCCCCHHHHCCC | 9.80 | 21609022 | |
198 | Phosphorylation | RSNYYDAYQAQPLAT CCCCCHHHHCCCCCC | 11.07 | 21609022 | |
207 | Phosphorylation | AQPLATRSSPRPGQP CCCCCCCCCCCCCCC | 40.10 | 23312004 | |
208 | Phosphorylation | QPLATRSSPRPGQPP CCCCCCCCCCCCCCC | 22.95 | 26657352 | |
216 | Ubiquitination | PRPGQPPKVKSEFNS CCCCCCCCCCCCCCC | 69.82 | 33845483 | |
218 | Ubiquitination | PGQPPKVKSEFNSYS CCCCCCCCCCCCCCC | 50.85 | 33845483 | |
218 | Sumoylation | PGQPPKVKSEFNSYS CCCCCCCCCCCCCCC | 50.85 | 22731716 | |
219 | Phosphorylation | GQPPKVKSEFNSYSL CCCCCCCCCCCCCCC | 50.86 | 28857561 | |
223 | Phosphorylation | KVKSEFNSYSLTGYV CCCCCCCCCCCCCCC | 22.78 | 22617229 | |
224 | Phosphorylation | VKSEFNSYSLTGYV- CCCCCCCCCCCCCC- | 14.59 | 27259358 | |
225 | Phosphorylation | KSEFNSYSLTGYV-- CCCCCCCCCCCCC-- | 21.19 | 28857561 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLD2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLD2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLD2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
KR412_HUMAN | KRTAP4-12 | physical | 16189514 | |
ZO1_HUMAN | TJP1 | physical | 10601346 | |
ZO2_HUMAN | TJP2 | physical | 22731716 | |
UBC9_HUMAN | UBE2I | physical | 22731716 | |
PIAS2_HUMAN | PIAS2 | physical | 22731716 | |
KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...