| UniProt ID | CLD2_HUMAN | |
|---|---|---|
| UniProt AC | P57739 | |
| Protein Name | Claudin-2 | |
| Gene Name | CLDN2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 230 | |
| Subcellular Localization |
Cell junction, tight junction. Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity.. | |
| Protein Sequence | MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYV | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 192 | Phosphorylation | CSSQRNRSNYYDAYQ CCCCCCCCCCCHHHH | 32.50 | 21253578 | |
| 194 | Phosphorylation | SQRNRSNYYDAYQAQ CCCCCCCCCHHHHCC | 12.17 | 21609022 | |
| 195 | Phosphorylation | QRNRSNYYDAYQAQP CCCCCCCCHHHHCCC | 9.80 | 21609022 | |
| 198 | Phosphorylation | RSNYYDAYQAQPLAT CCCCCHHHHCCCCCC | 11.07 | 21609022 | |
| 207 | Phosphorylation | AQPLATRSSPRPGQP CCCCCCCCCCCCCCC | 40.10 | 23312004 | |
| 208 | Phosphorylation | QPLATRSSPRPGQPP CCCCCCCCCCCCCCC | 22.95 | 26657352 | |
| 216 | Ubiquitination | PRPGQPPKVKSEFNS CCCCCCCCCCCCCCC | 69.82 | 33845483 | |
| 218 | Ubiquitination | PGQPPKVKSEFNSYS CCCCCCCCCCCCCCC | 50.85 | 33845483 | |
| 218 | Sumoylation | PGQPPKVKSEFNSYS CCCCCCCCCCCCCCC | 50.85 | 22731716 | |
| 219 | Phosphorylation | GQPPKVKSEFNSYSL CCCCCCCCCCCCCCC | 50.86 | 28857561 | |
| 223 | Phosphorylation | KVKSEFNSYSLTGYV CCCCCCCCCCCCCCC | 22.78 | 22617229 | |
| 224 | Phosphorylation | VKSEFNSYSLTGYV- CCCCCCCCCCCCCC- | 14.59 | 27259358 | |
| 225 | Phosphorylation | KSEFNSYSLTGYV-- CCCCCCCCCCCCC-- | 21.19 | 28857561 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CLD2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CLD2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CLD2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| KR412_HUMAN | KRTAP4-12 | physical | 16189514 | |
| ZO1_HUMAN | TJP1 | physical | 10601346 | |
| ZO2_HUMAN | TJP2 | physical | 22731716 | |
| UBC9_HUMAN | UBE2I | physical | 22731716 | |
| PIAS2_HUMAN | PIAS2 | physical | 22731716 | |
| KR103_HUMAN | KRTAP10-3 | physical | 25416956 | |
| NT2NL_HUMAN | NOTCH2NL | physical | 25416956 |
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
