UniProt ID | CELF5_HUMAN | |
---|---|---|
UniProt AC | Q8N6W0 | |
Protein Name | CUGBP Elav-like family member 5 | |
Gene Name | CELF5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 485 | |
Subcellular Localization | Nucleus. Cytoplasm. | |
Protein Description | RNA-binding protein implicated in the regulation of pre-mRNA alternative splicing. Mediates exon inclusion and/or exclusion in pre-mRNA that are subject to tissue-specific and developmentally regulated alternative splicing. Specifically activates exon 5 inclusion of cardiac isoforms of TNNT2 during heart remodeling at the juvenile to adult transition. Binds to muscle-specific splicing enhancer (MSE) intronic sites flanking the alternative exon 5 of TNNT2 pre-mRNA.. | |
Protein Sequence | MARLTESEARRQQQQLLQPRPSPVGSSGPEPPGGQPDGMKDLDAIKLFVGQIPRHLDEKDLKPLFEQFGRIYELTVLKDPYTGMHKGCAFLTYCARDSAIKAQTALHEQKTLPGMARPIQVKPADSESRGGRDRKLFVGMLNKQQSEEDVLRLFQPFGVIDECTVLRGPDGSSKGCAFVKFSSHTEAQAAIHALHGSQTMPGASSSLVVKFADTDKERTLRRMQQMVGQLGILTPSLTLPFSPYSAYAQALMQQQTTVLSTSGSYLSPGVAFSPCHIQQIGAVSLNGLPATPIAPASGLHSPPLLGTTAVPGLVAPITNGFAGVVPFPGGHPALETVYANGLVPYPAQSPTVAETLHPAFSGVQQYTAMYPTAAITPIAHSVPQPPPLLQQQQREGPEGCNLFIYHLPQEFGDTELTQMFLPFGNIISSKVFMDRATNQSKCFGFVSFDNPASAQAAIQAMNGFQIGMKRLKVQLKRPKDPGHPY | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | Phosphorylation | ---MARLTESEARRQ ---CCCCCHHHHHHH | 31.73 | 29083192 | |
7 | Phosphorylation | -MARLTESEARRQQQ -CCCCCHHHHHHHHH | 31.18 | 29083192 | |
92 | Phosphorylation | HKGCAFLTYCARDSA CCCCCHHHHHHHHHH | 15.31 | 19835603 | |
93 | Phosphorylation | KGCAFLTYCARDSAI CCCCHHHHHHHHHHH | 6.05 | 19835603 | |
101 | Ubiquitination | CARDSAIKAQTALHE HHHHHHHHHHHHHHH | 33.87 | 29967540 | |
104 | Phosphorylation | DSAIKAQTALHEQKT HHHHHHHHHHHHCCC | 35.73 | 19835603 | |
110 | Ubiquitination | QTALHEQKTLPGMAR HHHHHHCCCCCCCCC | 49.39 | 30230243 | |
122 | Ubiquitination | MARPIQVKPADSESR CCCCCEEECCCCCCC | 20.36 | 30230243 | |
129 | Dimethylation | KPADSESRGGRDRKL ECCCCCCCCCCCCHH | 47.75 | - | |
129 | Methylation | KPADSESRGGRDRKL ECCCCCCCCCCCCHH | 47.75 | - | |
132 | Dimethylation | DSESRGGRDRKLFVG CCCCCCCCCCHHHHH | 43.30 | - | |
132 | Methylation | DSESRGGRDRKLFVG CCCCCCCCCCHHHHH | 43.30 | - | |
174 | Ubiquitination | RGPDGSSKGCAFVKF ECCCCCCCCEEEEEE | 60.76 | 29967540 | |
387 (in isoform 2) | Phosphorylation | - | 53.00 | 28450419 | |
394 (in isoform 2) | Phosphorylation | - | 46.64 | 28450419 | |
396 (in isoform 2) | Phosphorylation | - | 27.96 | 28450419 | |
397 (in isoform 2) | Phosphorylation | - | 30.01 | 28450419 | |
398 (in isoform 2) | Phosphorylation | - | 83.60 | 28450419 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CELF5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CELF5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CELF5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PUM2_HUMAN | PUM2 | physical | 28514442 | |
SMAP2_HUMAN | SMAP2 | physical | 28514442 | |
PAI2B_HUMAN | PAIP2B | physical | 28514442 | |
TNKS1_HUMAN | TNKS | physical | 28514442 | |
ATX2_HUMAN | ATXN2 | physical | 28514442 | |
ERI3_HUMAN | ERI3 | physical | 28514442 | |
PUM1_HUMAN | PUM1 | physical | 28514442 | |
TNKS2_HUMAN | TNKS2 | physical | 28514442 | |
SYIM_HUMAN | IARS2 | physical | 28514442 | |
PAIP1_HUMAN | PAIP1 | physical | 28514442 | |
ELAV2_HUMAN | ELAVL2 | physical | 28514442 | |
CASC3_HUMAN | CASC3 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...