CDX2_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CDX2_HUMAN
• UniProt AC: Q99626
• Protein Name: Homeobox protein CDX-2
• Gene Name: CDX2
• Organism: Homo sapiens (Human).
• Sequence Length: 313
• Subcellular Localization: Nucleus.
• Protein Description: Involved in the transcriptional regulation of multiple genes expressed in the intestinal epithelium. Important in broad range of functions from early differentiation to maintenance of the intestinal epithelial lining of both the small and large intestine. Binds preferentially to methylated DNA. [PubMed: 28473536]
• Protein Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLELEKEFHYSRYITIRRKAELAATLGLSERQVKIWFQNRRAKERKINKKKLQQQQQQQPPQPPPPPPQPPQPQPGPLRSVPEPLSPVSSLQASVPGSVPGVLGPTGGVLNPTVTQ

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MYVSYLLDK ------CCCEECCCC	9.71	23663014
4	Phosphorylation	----MYVSYLLDKDV ----CCCEECCCCCH	7.80	23663014
5	Phosphorylation	---MYVSYLLDKDVS ---CCCEECCCCCHH	10.97	23663014
12	Phosphorylation	YLLDKDVSMYPSSVR ECCCCCHHCCCCCCC	23.80	20860994
14	Phosphorylation	LDKDVSMYPSSVRHS CCCCHHCCCCCCCCC	7.77	23663014
16	Phosphorylation	KDVSMYPSSVRHSGG CCHHCCCCCCCCCCC	24.79	23663014
17	Phosphorylation	DVSMYPSSVRHSGGL CHHCCCCCCCCCCCC	20.75	23663014
60	Phosphorylation	ANLDSAQSPGPSWPA HCCCCCCCCCCCCCH	31.38	11729123
176	Phosphorylation	MRKPAQQSLGSQVKT HHHHHHHHCCCCCCC	23.71	23312004
179	Phosphorylation	PAQQSLGSQVKTRTK HHHHHCCCCCCCCCC	36.77	27282143
226	Phosphorylation	LAATLGLSERQVKIW HHHHHCCCHHHHHHH	29.00	-
277	Phosphorylation	PQPGPLRSVPEPLSP CCCCCCCCCCCCCCC	50.10	25841592
283	Phosphorylation	RSVPEPLSPVSSLQA CCCCCCCCCCCCEEE	33.69	22817900
286	Phosphorylation	PEPLSPVSSLQASVP CCCCCCCCCEEECCC	28.81	25841592
287	Phosphorylation	EPLSPVSSLQASVPG CCCCCCCCEEECCCC	25.41	25841592
291	Phosphorylation	PVSSLQASVPGSVPG CCCCEEECCCCCCCC	18.84	27282143
295	Phosphorylation	LQASVPGSVPGVLGP EEECCCCCCCCCCCC	21.04	25841592
310	Phosphorylation	TGGVLNPTVTQ---- CCCCCCCCCCC----	34.80	27282143
312	Phosphorylation	GVLNPTVTQ------ CCCCCCCCC------	30.92	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
283	S	Phosphorylation	Kinase	CDK2	P24941	PSP
283	S	Phosphorylation	Kinase	GSK3B	P49841	PSP
283	S	Phosphorylation	Kinase	MAPK14	Q16539	GPS

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
60	S	Phosphorylation	Phosphorylation of Ser-60 mediates the transactivation capacity.	-

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CDX2_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
EP300_HUMAN	EP300	physical	10506141
PAX6_HUMAN	PAX6	physical	10506141
HNF1A_HUMAN	HNF1A	physical	10677375
SMCA2_HUMAN	SMARCA2	physical	19371634
SMCA4_HUMAN	SMARCA4	physical	19371634
SNF5_HUMAN	SMARCB1	physical	19371634
SMRD1_HUMAN	SMARCD1	physical	19371634
CDK2_HUMAN	CDK2	physical	16027724
TF65_HUMAN	RELA	physical	15013430
FBXW7_HUMAN	FBXW7	physical	27470268
GSK3B_HUMAN	GSK3B	physical	27470268

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.