UniProt ID | CDK4_MOUSE | |
---|---|---|
UniProt AC | P30285 | |
Protein Name | Cyclin-dependent kinase 4 | |
Gene Name | Cdk4 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 303 | |
Subcellular Localization | Cytoplasm. Nucleus. Membrane. Cytoplasmic when non-complexed. Forms a cyclin D-CDK4 complex in the cytoplasm as cells progress through G(1) phase. The complex accumulates on the nuclear membrane and enters the nucleus on transition from G(1) to S pha | |
Protein Description | Ser/Thr-kinase component of cyclin D-CDK4 (DC) complexes that phosphorylate and inhibit members of the retinoblastoma (RB) protein family including RB1 and regulate the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complexes and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also phosphorylates SMAD3 in a cell-cycle-dependent manner and represses its transcriptional activity. Component of the ternary complex, cyclin D/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity).. | |
Protein Sequence | MAATRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGAAGGGLPVSTVREVALLRRLEAFEHPNVVRLMDVCATSRTDRDIKVTLVFEHIDQDLRTYLDKAPPPGLPVETIKDLMRQFLSGLDFLHANCIVHRDLKPENILVTSNGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPREVSLPRGAFAPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKEESDAE | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAATRYEPV ------CCCCCEECC | 19.96 | - | |
78 | Glutathionylation | VVRLMDVCATSRTDR EEEEEEHHHCCCCCC | 2.73 | 24333276 | |
172 | Phosphorylation | YSYQMALTPVVVTLW EEHHHCCCCHHHHHH | 12.42 | 22817900 | |
293 | Phosphorylation | AFRALQHSYLHKEES HHHHHHHHHHHHHHH | 19.21 | 25619855 | |
294 | Phosphorylation | FRALQHSYLHKEESD HHHHHHHHHHHHHHC | 15.65 | 25619855 | |
300 | Phosphorylation | SYLHKEESDAE---- HHHHHHHHCCC---- | 43.12 | 27087446 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
172 | T | Phosphorylation | Kinase | CDK7 | Q03147 | PhosphoELM |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CDK4_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CDN1B_MOUSE | Cdkn1b | physical | 11967266 | |
CDN1A_MOUSE | Cdkn1a | physical | 11967266 | |
RUNX3_HUMAN | RUNX3 | physical | 19351720 | |
CCND1_MOUSE | Ccnd1 | physical | 17699765 | |
CDN1B_MOUSE | Cdkn1b | physical | 17699765 | |
RB_MOUSE | Rb1 | physical | 15158336 | |
CCND2_MOUSE | Ccnd2 | physical | 9584157 | |
CDN1B_MOUSE | Cdkn1b | physical | 8822197 | |
RB_MOUSE | Rb1 | physical | 8547220 | |
CEBPA_MOUSE | Cebpa | physical | 20516642 | |
CCND1_MOUSE | Ccnd1 | physical | 20516642 | |
PSD10_MOUSE | Psmd10 | physical | 20516642 | |
CCND3_MOUSE | Ccnd3 | physical | 11254678 | |
RB_MOUSE | Rb1 | physical | 11254678 | |
H11_MOUSE | Hist1h1a | physical | 12007403 | |
PCNA_MOUSE | Pcna | physical | 12970760 | |
CDN1A_MOUSE | Cdkn1a | physical | 12970760 | |
CCND1_MOUSE | Ccnd1 | physical | 12970760 | |
H12_MOUSE | Hist1h1c | physical | 12970760 | |
CCND1_MOUSE | Ccnd1 | physical | 23707388 | |
HS90A_MOUSE | Hsp90aa1 | physical | 11867521 | |
CDC37_MOUSE | Cdc37 | physical | 11867521 | |
CCND1_MOUSE | Ccnd1 | physical | 16331266 | |
H15_MOUSE | Hist1h1b | physical | 16627785 | |
MEF2D_HUMAN | MEF2D | physical | 25733682 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...