CCND2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: CCND2_MOUSE
• UniProt AC: P30280
• Protein Name: G1/S-specific cyclin-D2
• Gene Name: Ccnd2
• Organism: Mus musculus (Mouse).
• Sequence Length: 289
• Subcellular Localization: Nucleus. Cytoplasm. Membrane. Cyclin D-CDK4 complexes accumulate at the nuclear membrane and are then translocated into the nucleus through interaction with KIP/CIP family members..
• Protein Description: Regulatory component of the cyclin D2-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D2/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex (By similarity)..
• Protein Sequence: MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDDEVNTLTCDALTELLAKITHTDVDCLKACQEQIEALLLNSLQQFRQEQHNAGSKSVEDPDQATTPTDVRDVDL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
271	Phosphorylation	QHNAGSKSVEDPDQA HHHCCCCCCCCCCCC	32.22	-
279	Phosphorylation	VEDPDQATTPTDVRD CCCCCCCCCCCCCCC	27.89	25619855
280	Phosphorylation	EDPDQATTPTDVRDV CCCCCCCCCCCCCCC	27.49	26824392
282	Phosphorylation	PDQATTPTDVRDVDL CCCCCCCCCCCCCCC	45.06	25619855

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of CCND2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of CCND2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of CCND2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of CCND2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.