UniProt ID | CALR3_HUMAN | |
---|---|---|
UniProt AC | Q96L12 | |
Protein Name | Calreticulin-3 | |
Gene Name | CALR3 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 384 | |
Subcellular Localization | Endoplasmic reticulum lumen . | |
Protein Description | During spermatogenesis, may act as a lectin-independent chaperone for specific client proteins such as ADAM3. Required for sperm fertility (By similarity). CALR3 capacity for calcium-binding may be absent or much lower than that of CALR.. | |
Protein Sequence | MARALVQLWAICMLRVALATVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
42 | N-linked_Glycosylation | NRWLQSTNDSRFGHF HHHCCCCCCCCCCEE | 50.97 | UniProtKB CARBOHYD | |
57 | Phosphorylation | RLSSGKFYGHKEKDK EECCCCCCCCCCCCC | 23.08 | - | |
68 | Phosphorylation | EKDKGLQTTQNGRFY CCCCCCEECCCCEEE | 35.08 | 22210691 | |
69 | Phosphorylation | KDKGLQTTQNGRFYA CCCCCEECCCCEEEE | 13.69 | 28555341 | |
78 | Phosphorylation | NGRFYAISARFKPFS CCEEEEEEEEEEECC | 12.76 | 22210691 | |
89 | Acetylation | KPFSNKGKTLVIQYT EECCCCCCEEEEEEE | 40.05 | 7976105 | |
201 | N-linked_Glycosylation | GSIEYDWNLTSLKKE CEEEEEEECCCCCCC | 30.46 | UniProtKB CARBOHYD | |
209 | Phosphorylation | LTSLKKETSPAESKD CCCCCCCCCCCCCCC | 49.22 | - | |
210 | Phosphorylation | TSLKKETSPAESKDW CCCCCCCCCCCCCCH | 24.17 | - | |
214 | Phosphorylation | KETSPAESKDWEQTK CCCCCCCCCCHHHHC | 37.71 | - | |
230 | Acetylation | NKAQDWEKHFLDAST CCHHHHHHHCCCCCC | 35.09 | 20167786 | |
374 | Phosphorylation | KINRHEHYFNQFHRR CCHHHHHHHHHHHHH | 10.97 | 24719451 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of CALR3_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of CALR3_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of CALR3_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
UBR5_HUMAN | UBR5 | physical | 26186194 | |
FAT1_HUMAN | FAT1 | physical | 26186194 | |
OS9_HUMAN | OS9 | physical | 26186194 | |
GPR98_HUMAN | GPR98 | physical | 26186194 | |
ITA8_HUMAN | ITGA8 | physical | 26186194 | |
FREM2_HUMAN | FREM2 | physical | 26186194 | |
CLN5_HUMAN | CLN5 | physical | 26186194 | |
T132A_HUMAN | TMEM132A | physical | 26186194 | |
UBR5_HUMAN | UBR5 | physical | 28514442 | |
GPR98_HUMAN | GPR98 | physical | 28514442 | |
ITA8_HUMAN | ITGA8 | physical | 28514442 | |
T132A_HUMAN | TMEM132A | physical | 28514442 | |
CLN5_HUMAN | CLN5 | physical | 28514442 | |
TXD16_HUMAN | TXNDC16 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
613875 | Cardiomyopathy, familial hypertrophic 19 (CMH19) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...