UniProt ID | AURKC_HUMAN | |
---|---|---|
UniProt AC | Q9UQB9 | |
Protein Name | Aurora kinase C | |
Gene Name | AURKC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 309 | |
Subcellular Localization | Nucleus. Chromosome. Chromosome, centromere . Cytoplasm, cytoskeleton, spindle . Distributes in the condensed chromosomes during prophase to metaphase. After entering anaphase, there is a dissociation from separated chromosomes and a redistribution t | |
Protein Description | Serine/threonine-protein kinase component of the chromosomal passenger complex (CPC), a complex that acts as a key regulator of mitosis. The CPC complex has essential functions at the centromere in ensuring correct chromosome alignment and segregation and is required for chromatin-induced microtubule stabilization and spindle assembly. Plays also a role in meiosis and more particularly in spermatogenesis. Has redundant cellular functions with AURKB and can rescue an AURKB knockdown. Like AURKB, AURKC phosphorylates histone H3 at 'Ser-10' and 'Ser-28'. AURKC phosphorylates the CPC complex subunits BIRC5/survivin and INCENP leading to increased AURKC activity. Phosphorylates TACC1, another protein involved in cell division, at 'Ser-228'.. | |
Protein Sequence | MSSPRAVVQLGKAQPAGEELATANQTAQQPSSPAMRRLTVDDFEIGRPLGKGKFGNVYLARLKESHFIVALKVLFKSQIEKEGLEHQLRREIEIQAHLQHPNILRLYNYFHDARRVYLILEYAPRGELYKELQKSEKLDEQRTATIIEELADALTYCHDKKVIHRDIKPENLLLGFRGEVKIADFGWSVHTPSLRRKTMCGTLDYLPPEMIEGRTYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPLGARDLISRLLRYQPLERLPLAQILKHPWVQAHSRRVLPPCAQMAS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
17 | Ubiquitination | LGKAQPAGEELATAN CCCCCCCCHHHHHHH | 35.28 | 22817900 | |
19 (in isoform 2) | Ubiquitination | - | 42.67 | 21890473 | |
19 | Ubiquitination | KAQPAGEELATANQT CCCCCCHHHHHHHHC | 42.67 | 27667366 | |
22 | Phosphorylation | PAGEELATANQTAQQ CCCHHHHHHHHCCCC | 38.47 | 24043423 | |
26 | Phosphorylation | ELATANQTAQQPSSP HHHHHHHCCCCCCCH | 26.66 | 24043423 | |
31 | Phosphorylation | NQTAQQPSSPAMRRL HHCCCCCCCHHHHHC | 44.61 | 24043423 | |
32 | Ubiquitination | QTAQQPSSPAMRRLT HCCCCCCCHHHHHCE | 24.30 | 22817900 | |
32 | Phosphorylation | QTAQQPSSPAMRRLT HCCCCCCCHHHHHCE | 24.30 | 24043423 | |
34 | Ubiquitination | AQQPSSPAMRRLTVD CCCCCCHHHHHCEEC | 13.18 | 21890473 | |
34 | Ubiquitination | AQQPSSPAMRRLTVD CCCCCCHHHHHCEEC | 13.18 | 27667366 | |
51 | Ubiquitination | EIGRPLGKGKFGNVY ECCCCCCCCCCCCEE | 67.61 | 22817900 | |
53 (in isoform 1) | Ubiquitination | - | 54.29 | 21890473 | |
53 | Ubiquitination | GRPLGKGKFGNVYLA CCCCCCCCCCCEEEE | 54.29 | 27667366 | |
58 | Phosphorylation | KGKFGNVYLARLKES CCCCCCEEEECCCCH | 9.92 | 17192257 | |
76 | Ubiquitination | VALKVLFKSQIEKEG HEEHHHHHHHHHHCC | 36.97 | - | |
77 | Phosphorylation | ALKVLFKSQIEKEGL EEHHHHHHHHHHCCH | 29.11 | - | |
96 | Ubiquitination | RREIEIQAHLQHPNI HHHHHHHHHCCCCCH | 15.83 | 21890473 | |
96 (in isoform 2) | Ubiquitination | - | 15.83 | 21890473 | |
100 | Ubiquitination | EIQAHLQHPNILRLY HHHHHCCCCCHHHHH | 24.59 | 22817900 | |
111 | Ubiquitination | LRLYNYFHDARRVYL HHHHHHHHHHHHEEE | 19.91 | 21890473 | |
115 | Ubiquitination | NYFHDARRVYLILEY HHHHHHHHEEEEEEC | 24.13 | 22817900 | |
129 | Phosphorylation | YAPRGELYKELQKSE CCCCCHHHHHHHHHH | 9.71 | 29496907 | |
130 | Ubiquitination | APRGELYKELQKSEK CCCCHHHHHHHHHHC | 65.65 | 21890473 | |
130 (in isoform 1) | Ubiquitination | - | 65.65 | 21890473 | |
134 | Ubiquitination | ELYKELQKSEKLDEQ HHHHHHHHHHCCCHH | 73.53 | 22817900 | |
143 | Phosphorylation | EKLDEQRTATIIEEL HCCCHHHHHHHHHHH | 28.04 | 24719451 | |
149 | Ubiquitination | RTATIIEELADALTY HHHHHHHHHHHHHHH | 38.56 | 22817900 | |
156 | Phosphorylation | ELADALTYCHDKKVI HHHHHHHHHCCCCEE | 6.66 | 24719451 | |
163 | Ubiquitination | YCHDKKVIHRDIKPE HHCCCCEECCCCCHH | 2.79 | 22505724 | |
168 | Ubiquitination | KVIHRDIKPENLLLG CEECCCCCHHHEEEE | 51.04 | 22817900 | |
178 | Ubiquitination | NLLLGFRGEVKIADF HEEEEEEEEEEEECC | 41.61 | 22505724 | |
193 | Phosphorylation | GWSVHTPSLRRKTMC CCCCCCHHHCCCCCC | 35.35 | 24719451 | |
197 | Ubiquitination | HTPSLRRKTMCGTLD CCHHHCCCCCCCCCC | 33.89 | 22505724 | |
197 | Acetylation | HTPSLRRKTMCGTLD CCHHHCCCCCCCCCC | 33.89 | 28735677 | |
198 | Phosphorylation | TPSLRRKTMCGTLDY CHHHCCCCCCCCCCC | 18.84 | 22322096 | |
202 | Phosphorylation | RRKTMCGTLDYLPPE CCCCCCCCCCCCCHH | 16.13 | 22322096 | |
205 | Phosphorylation | TMCGTLDYLPPEMIE CCCCCCCCCCHHHHC | 24.99 | 20068231 | |
271 | Phosphorylation | LGARDLISRLLRYQP CCHHHHHHHHHHCCC | 24.95 | 22210691 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
198 | T | Phosphorylation | Kinase | PKA | - | Uniprot |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of AURKC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of AURKC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
CENPA_HUMAN | CENPA | physical | 20663916 | |
TACC2_HUMAN | TACC2 | physical | 14602875 | |
H31_HUMAN | HIST1H3A | physical | 15316025 | |
BIRC5_HUMAN | BIRC5 | physical | 21988832 | |
HS90A_HUMAN | HSP90AA1 | physical | 26186194 | |
HS90B_HUMAN | HSP90AB1 | physical | 26186194 | |
FKBP5_HUMAN | FKBP5 | physical | 26186194 | |
CDC37_HUMAN | CDC37 | physical | 26186194 | |
MYH1_HUMAN | MYH1 | physical | 26186194 | |
MYH8_HUMAN | MYH8 | physical | 26186194 | |
MYH4_HUMAN | MYH4 | physical | 26186194 | |
UBP19_HUMAN | USP19 | physical | 26186194 | |
TBB8_HUMAN | TUBB8 | physical | 26186194 | |
INCE_HUMAN | INCENP | physical | 26186194 | |
CL043_HUMAN | C12orf43 | physical | 26186194 | |
PRP16_HUMAN | DHX38 | physical | 26186194 | |
MYH8_HUMAN | MYH8 | physical | 28514442 | |
INCE_HUMAN | INCENP | physical | 28514442 | |
MYH1_HUMAN | MYH1 | physical | 28514442 | |
MYH4_HUMAN | MYH4 | physical | 28514442 | |
CL043_HUMAN | C12orf43 | physical | 28514442 | |
UBP19_HUMAN | USP19 | physical | 28514442 | |
PRP16_HUMAN | DHX38 | physical | 28514442 | |
HS90A_HUMAN | HSP90AA1 | physical | 28514442 | |
FKBP5_HUMAN | FKBP5 | physical | 28514442 | |
CDK5_HUMAN | CDK5 | physical | 28514442 | |
HS90B_HUMAN | HSP90AB1 | physical | 28514442 |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
243060 | Spermatogenic failure 5 (SPGF5) | |||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...