ATP19_YEAST - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: ATP19_YEAST
• UniProt AC: P81451
• Protein Name: ATP synthase subunit K, mitochondrial
• Gene Name: ATP19
• Organism: Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
• Sequence Length: 68
• Subcellular Localization: Mitochondrion inner membrane; Single-pass membrane protein.
• Protein Description: Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F(1) - containing the extramembraneous catalytic core and F(0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F(0) domain. Minor subunit located with subunit a in the membrane. The K chain binds the dimeric form by interacting with the G and E chains..
• Protein Sequence: MGAAYHFMGKAIPPHQLAIGTLGLLGLLVVPNPFKSAKPKTVDIKTDNKDEEKFIENYLKKHSEKQDA

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
53	Acetylation	TDNKDEEKFIENYLK CCCCCHHHHHHHHHH	49.98	24489116

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of ATP19_YEAST !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of ATP19_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of ATP19_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
RL22A_YEAST	RPL22A	genetic	20093466
KCS1_YEAST	KCS1	genetic	21623372
KTR5_YEAST	KTR5	genetic	21623372
DCOR_YEAST	SPE1	genetic	21623372
GDE1_YEAST	GDE1	genetic	21623372
INP51_YEAST	INP51	genetic	21623372
ERG2_YEAST	ERG2	genetic	21623372
SPSY_YEAST	SPE4	genetic	21623372
IPYR_YEAST	IPP1	genetic	27708008
ERF3_YEAST	SUP35	genetic	27708008
RNA1_YEAST	RNA1	genetic	27708008

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.